Conserved Protein Domain Family
DUF2552

?
pfam10827: DUF2552 
Protein of unknown function (DUF2552)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 371260
View PSSM: pfam10827
Aligned: 7 rows
Threshold Bit Score: 139.546
Threshold Setting Gi: 81715020
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q81MC0        2 DKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL 79  Bacillus anthracis
MA:Aflv_0987  5 NDQVNRLRKIAKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPHITDIL 82  Anoxybacillus flav...
WP_015864395  2 KDKLKQIANVAKQKTWVSFLHENDPYSLLHWSIAGVYHEPKDVWLLQNEMTFETKEFATLDEAIAWMDEHMPNITEIL 79  Bacillaceae
Q5KXH6        2 NGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEEAIAWLGEHMPHITEVL 79  Geobacillus kausto...
ABV62766      2 DQKLKVIQNTAQNKTWVSFLNNNHPYTLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVNWIKENMEQVTDVL 79  Bacillus pumilus S...
Q65HR9        2 NQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL 79  Bacillus lichenifo...
P54566        2 EQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL 79  Bacillus subtilis ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap