Conserved Protein Domain Family
Herpesvir_UL11

?
pfam10813: Herpesvir_UL11 
Herpesvirus UL11 homologue
This entry contains viral proteins that are involved in virion envelopment and egress. It includes Epstein-Barr virus (EBV) BBLF1 protein (also known as cytoplasmic envelopment protein 3), which is present in the tegument layer of EBV and is involved in virion maturation. BBLF1 also participates in viral entry at the fusion step probably by regulating the core fusion machinery. BBLF1 has been shown to localise to the trans-Golgi network along with gp350/220, a site where final envelopment of EBV particles takes place. BBLF1 shares 13 to 15% amino acid sequence identity with the herpes simplex virus 1 UL11 and cytomegalovirus UL99 tegument proteins, and like these it is a myristoylated and palmitoylated protein.
Statistics
?
PSSM-Id: 287750
Aligned: 5 rows
Threshold Bit Score: 52.3911
Created: 15-Feb-2025
Updated: 28-Apr-2025
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O36387  1 MGSYISVCCWRRHSIkDVHGNDINIAEDFEAF 32  Alcelaphine herpesvirus 1 strain C500
F5HHY1  1 MGFLLSICKRPSQPV-DVDGEPLDVVVDYDPI 31  Human herpesvirus 8 strain GK18
Q66642  1 MGILLSICRRRHDPLtDVEGQPINVREEFEMF 32  Equid herpesvirus type 2 strain 86/87
P0CK51  1 MGALWSLCRRRVNSIgDVDGGIINLYNDYEEF 32  Epstein-Barr virus (strain B95-8)
Q01025  1 MGTLCSVCKRRPNPV-DTEGKVINVTDDFEEM 31  Herpesvirus saimiri (strain 11)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap