Conserved Protein Domain Family
DUF2545

?
pfam10810: DUF2545 
Protein of unknown function (DUF2545)
This family of proteins with unknown function is restricted to Enterobacteriaceae. The sequence is highly conserved.
Statistics
?
PSSM-Id: 371254
View PSSM: pfam10810
Aligned: 5 rows
Threshold Bit Score: 78.6482
Threshold Setting Gi: 700335998
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003028231            1 MLYFWIFLALSILCVSCYIWQVMGAAASISAFLGMAILTALIYFFTMRLTNGNEMVTGLFLFLAPACGLIIRFMVGYGKQ 80  Entero...
Q7CQ31                  1 MIYLWTFLAISILAVSGYIGQVMGAFSAVSSFTGMVILAALIYLLNVWLQDGDDIVSGLLLFLAPACGLIIRFMVGYGKR 80  Salmon...
Q32DG6                  1 MIYLWMFLALCIVCVSGYIGQVLNVVSAVSSFFGMVILAALIYYFTMWLTGGNELVTGIFMFLAPACGLMIRFMVGYGRR 80  Shigel...
goetting:EBL_c21150     2 MIYLLFAVLIAILSVSYYTGSVSGYKAGIASLLVMLILAGGINHFTLWLTQGNALVSGIFSLLSPAIGAIFMLMMSNGKR 81  Shimwe...
PRJNA236111:AT03_08880  3 PLYGFVILSLAILTVSLFAYSRRGGIYAIFSCLGMVILAAALYFAAFYISDGAELTAGIATLLSPIAGALIVFTTSYAVR 82  Hafnia...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap