Conserved Protein Domain Family
DUF2542

?
pfam10808: DUF2542 
Protein of unknown function (DUF2542)
This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. The family has a highly conserved sequence.
Statistics
?
PSSM-Id: 151258
View PSSM: pfam10808
Aligned: 3 rows
Threshold Bit Score: 121.849
Threshold Setting Gi: 501081004
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012131622  1 MEGKTIFVVIAVLMVMLFSLREAYKGWRSGAVDKIVRNAREPVYAYRAETPLLYWSYIGLYLCMSVCTLAAGIYFLFFR 79  Citrobacter koseri
Q7CQ79        3 MDVQTIFVILAFLLLPLFCFREAWKGWRTGAVDKVVKNARKPVYVYRHADPVQYWSYLFLYTGCGFLFTGMIIYLLFYR 81  Salmonella enteri...
P64536        1 MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVAYIGFGILSIGMIVYLIFYR 79  Escherichia coli ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap