Conserved Protein Domain Family
Anti-adapt_IraP

?
pfam10796: Anti-adapt_IraP 
Sigma-S stabilisation anti-adaptor protein
This family is conserved in Enterobacteriaceae. It is one of a series of proteins, expressed by these bacteria in response to stress, that help to regulate Sigma-S, the stationary phase sigma factor of Escherichia coli and Salmonella. IraP is essential for Sigma-S stabilisation in some but not all starvation conditions.
Statistics
?
PSSM-Id: 402432
View PSSM: pfam10796
Aligned: 13 rows
Threshold Bit Score: 84.6394
Threshold Setting Gi: 291154024
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAN96480              1 MKNVVLSMLAKISQIDATTKQLTARVEAQSLLIGALVLAVSKKgGVTEVIESANKAINMVIESaeADDMLKSDAAILLSE 80  Plautia ...
KFD14534              1 MKNIILSMVAKISRMEADSKQLTAQVEAQSLLLSAIFLTVGKNgGPQEIIESVNKAINSALDS--ADEVLKSDAKILFEQ 78  Rahnella...
CAX58681              1 MKNVIFSMLAKISKMDAESKQLTAQVEAQSLLIGALTLTVGKNgGMTRMVESVNKAINSVLDS--QDDVLRSDADILLNE 78  Erwinia ...
ADD78608              2 MKSAVLSMLAKISKMDAETKELVAQTEAQSLLLSALTLTVGKSgGVEELISAISQAINTVLES--SDGLIKSDAELLLTK 79  Pantoea ...
CAX60742              3 MRNLMIGILMKMSKMDEKAKELTAQVEAQSLLLGVLTLTQGKNgGVKSMNGDVDKAFISALKS--SESFLSSDVDLVMKY 80  Erwinia ...
WP_025423206          1 MKNLVIDLLIKMAKADVQTKELTAQVEAQSLLLAALVLTVGKG-IPASMSSNIQKAILSAPEA--SAEILSSDADLLLAH 77  Sodalis ...
Q6D358                1 MNNILSHLLIKLAEKEVGEKALNAKIESLEMLISAIVSTFDDG-KINELNKKIEGVVADASQR--KDEHNYLAFELLEKN 77  Pectobac...
WP_025422753          1 MNSLLSQLLIRLAQKEAAEKELLALVQSLEILVAALISSLSPD-KLNELVGSIDMAMKNLPRN--LEAGHNADIDLLNNN 77  Sodalis ...
CAX58476              1 MKNLIAELLVRLAEKEEESKELVAQVEALEIVVTALLRKLDSH-QFQQISDSITTAMDTATRS---ETINPEDSSLLEGY 76  Erwinia ...
A6T5A7                1 MKNLIAELLVKLAQKEEEAKELTVQVEALEIVVTALLRHMEHD-AQQALIQDIEQAIDQVTPC---PPVNDHDAMLLQQY 76  Klebsiel...
goetting:EBL_c29410   1 MRYLISELLVNIAAREEESVRLEHRVAVMEIFFRQMMDKMSSE-ERQRLIDGVRDKVAHNDSG-----PVSYDTALLQQQ 74  Shimwell...
P0AAN9                1 MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQN-DQQRLIDQVEGALYEVKPD---ASIPDDDTELLRDY 76  Escheric...
WP_013200945          1 MKQLVIDILMKIAKIDVDAKELTAQVEAQSLLIAALLLTAGKE-GANNISENIQNAIVTASSS--GQGFMQSDVDLLLTH 77  Erwinia
BAN96480             81 FQDLLTISR 89  Plautia stali symbiont
KFD14534             79 FQALIELTR 87  Rahnella aquatilis CIP 78.65 = ATCC 33071
CAX58681             79 FRNLLEVTR 87  Erwinia billingiae Eb661
ADD78608             80 FQEQLTLTR 88  Pantoea ananatis LMG 20103
CAX60742             81 YKQLISITR 89  Erwinia billingiae Eb661
WP_025423206         78 FDRLISVSh 86  Sodalis praecaptivus
Q6D358               78 INRITTVSL 86  Pectobacterium atrosepticum
WP_025422753         78 ITRITAVAR 86  Sodalis praecaptivus
CAX58476             77 IQRLLLHPR 85  Erwinia billingiae Eb661
A6T5A7               77 LKKLLRHPR 85  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
goetting:EBL_c29410  75 MNRLLd--- 80  Shimwellia blattae DSM 4481 = NBRC 105725
P0AAN9               77 VKKLLKHPR 85  Escherichia coli K-12
WP_013200945         78 VNRLLAVTR 86  Erwinia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap