Conserved Protein Domain Family
Gloverin

?
pfam10793: Gloverin 
Gloverin-like protein
This family of proteins are Gloverin-like. Gloverin is a 13.8kDa inducible antibacterial insect protein which inhibits the synthesis of vital outer membrane proteins leading to a permeable outer membrane. Gloverin contains a large number of glycine residues.
Statistics
?
PSSM-Id: 371249
View PSSM: pfam10793
Aligned: 2 rows
Threshold Bit Score: 287.316
Threshold Setting Gi: 122003831
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_028035365  18 QVSMPPGYAEKYPITSQFSRsvRHPRDihdfVTWDKEMGGGKVFGTLGESDQGLFGKGGYNREFFNDDRGKLTGQAYGTR 97  wild silkworm
Q2WGL1        19 EVYGPSDYAEDYSISGQSSR--RHPRD----VTWDKQMGGGKVFGTLGQNDDGLFGKAGYNKEIFNDDRGKLTGQAYGTR 92  domestic silkworm
XP_028035365  98 VLGPGGDSTSYGGRLDWANENAKAAIDLNRQIGGSAGIEASASGVWDLGKNTHLSAGGVVSKEFGHRRPDVGLQAQITHE 177 wild silkworm
Q2WGL1        93 VLGPGGDSTNYGGRLDWANKNAQATIDLNRQIGGRSGMTASGSGVWDLDKNTHFSAGGMVSKEFGHKRPDVGLQAEIRHD 172 domestic silkworm
XP_028035365 178 W 178 wild silkworm
Q2WGL1       173 W 173 domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap