Conserved Protein Domain Family
YfmQ

?
pfam10787: YfmQ 
Uncharacterized protein from bacillus cereus group
This family is conserved in the Bacillus cereus group. Several members are called YfmQ but the function is not known.
Statistics
?
PSSM-Id: 402426
View PSSM: pfam10787
Aligned: 5 rows
Threshold Bit Score: 200.44
Threshold Setting Gi: 81435218
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABV62770   1 M-VWIVT-SLVVFSLLKLLVTSLPSGVVERLFSRYAVHAKVTSDQTTIMFEDRPLDDQQASDIIQHFNDAIFIERYYIYP 78  Bacillus pumilus SA...
O06475     1 M-TWAIV-MLILMSLVKIVLTCLPTGVIEWLLGKFEVHAKLSDENASLSLDGKRLEGAEKQKVIDQFNEAIFLEKYYIYP 78  Bacillus subtilis s...
Q65MZ5     1 M-TWLFVtFLVIFSLFKILVTCLPSGVVEWLTGKFQVHVKLEESNVQVTFGGKRLEGSDKSRFIQNFNEAVFMERYYIYP 79  Bacillus lichenifor...
Q81WT5     5 T-TWFIV-TLFIFGALKVLVSSMPTSVVESIISRFELHQKLDEENTSISIDGKNIEGEMKLQVIHEFNEALFLDKHYFPP 82  Bacillus anthracis
Q81FA6     1 MtTWFIV-MLVVFGAFKIIVSSLPNSVIESIISKYETHPKLEEENVTITIHGNNVEGEQKSKIIHDFNEGLFLDRYYAPP 79  Bacillus cereus ATC...
ABV62770  79 GDEERFLHPQEGPAPLTMQTKLGKHDVTLYLYHYDDHVDVVRQFthkpKKKLTAYRLRSEPLQTSYN 145 Bacillus pumilus SAFR-032
O06475    79 GDEERYLHPENGGTPLVIDTKKGKKDVKLFVYRYDDHIDVVKQY----KKKVIAYRVLSESLQKESL 141 Bacillus subtilis subsp. subtili...
Q65MZ5    80 GDEPLYVNPKNAGTPFVIETTKGKNAVKLFVYRYDDHIDVVKQY----KKKTAAYCLRSDSLQTCGG 142 Bacillus licheniformis DSM 13 = ...
Q81WT5    83 HGE---------GTPIVIDTKKGNKEIRFSLYSYEEHVDVIKQY----KKKVVAYRLRSKSLQTRAP 136 Bacillus anthracis
Q81FA6    80 HNE---------GTPLIIHAKRGKKDFTFYIYSHEEHVDVVKQY----KKKVVAYSLRSKNLQN-SD 132 Bacillus cereus ATCC 14579
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap