Conserved Protein Domain Family
G6PD_bact

?
pfam10786: G6PD_bact 
Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)
This family is conserved in Firmicutes and Proteobacteria. Several members are annotated as being glucose-6-phosphate 1-dehydrogenase (EC:1.1.1.49) but this could not be confirmed.
Statistics
?
PSSM-Id: 402425
View PSSM: pfam10786
Aligned: 10 rows
Threshold Bit Score: 290.463
Threshold Setting Gi: 81707163
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q74IK4                 4 LTNKMYEIFDQEEFSFKKLKVNKTPEEIDTIKQEFKGVWQIWKTVQLNVAEQLPTG-KFAKVHVESWTNGWNLRDHFWAS 82  Lactoba...
WP_003669458           4 LTENMFAIFDQPEFSFKKIKETHSPEEVADLKEKFKAVWQVWKKVNQTVASQLPTG-KFAKVHVESWTNGWNLRDHYWAS 82  Lactoba...
Q7DDA9                 2 LTPKSCDLFNIPFFQFSQLKK-YQPESIPQIKADYKENWQIWQQLIQQVAAELGA--PFAPPHIERWCNGWQVRAHFFAY 78  Neisser...
WP_015431718           2 LTIQSCELFNLPFFQFSQLKK-YCPQDIPKIKTDYKYHWHIWKTLHQEVSMRLGM--PFAEPHVEKWCNGWQVRAHFFAY 78  Biberst...
jgi:Asuc_0735          2 ISPAACDVFNIPFFQFSQLKK-YCPEDIPRIKADYKYQWNEWKNTILQVSKQLGA--SFAEPHIEKWCNGWQVRAHFFAY 78  Actinob...
P44013                 4 LTAESCELFNIPFYQFAQMKK-FCPEDIPAIKADYKLHWDNWKAIIQSVSAQLGT--PFAKPHIESWTNGWQVRAHFFAY 80  Haemoph...
microsynth:EHR_03470   3 llTSDYELFDRSMFTFKQLKERYTTEELAQLKVRYQTHWQKWKKMNEQVAKATPLQwQMRKPKIESWTNGWNLRSHFWCA 82  Enteroc...
Q3XXE3                 3 LGKSDYQLFDRPIYAFKQLKESHPTDKIEQIKKEYKEHWQKWKEIQLQTAALLPDMyGMSKPKIESWTNGWNLRSHFWSA 82  Enteroc...
WP_005470767           3 fAKADFDLFDREVFAFKQIKDIYPPETIQRLKEDYQMSWQKWKHIQMTVATNVSADl---QPKVESWTNGWNLRSHFWCA 79  Enteroc...
Q82ZP4                 3 LTHQDFNLFNREIFTFKQLKEQQTSAEIDALKQTYKQHWEKWKALNLAIAQGLPAElGITKPKIESWTNGWNLRSHFWAA 82  Enteroc...
Q74IK4                83 YRLTSLADYNPCIGVMLDKKQLQVYLMFQYYKSDKRQGTVSEYNTLLTDISKWGSSLD---ISNWYLWDKNEMEFSNHLA 159 Lactoba...
WP_003669458          83 YRLALLAEYNPCIGVMLAKKQLQVYLMFQHYKSEQRQSTPDEYNKLLDKVPEWADNID---ATHWYLWDKDEMEFSDHLS 159 Lactoba...
Q7DDA9                79 FKYEQYKNSAAILSILLNRRRLSVSLDWHCYKADVSPIALPDYNR-------WLDNFDtekYASFDMWHGAESEYDDYRT 151 Neisser...
WP_015431718          79 YKYVFNPHSAAIFSVILNRRRLQVCLDWHAYRANRSSIQLAEYNQ-------WLEHLNhkkYADFDIWHGAESEYSDFNK 151 Biberst...
jgi:Asuc_0735         79 FKYEFNKNSAAILSVLLNRRRLQASLDWHCYRADRSQISLRQYNQ-------WLQDFDfqrFADFEIWRGDESEYADFSQ 151 Actinob...
P44013                81 FKYEFNQNSAAIFSVLLNRRRLRVCLDWHCYRADRSQINVQQYNQ-------WLDQFDfkqFADFEIWREDESEYDDFRQ 153 Haemoph...
microsynth:EHR_03470  83 YRSEGRQQENACLATLLNKKQFQIYLMFQHYKSEERQGSISSFNHLLTVLKEWSKHIP---VEEYYIWPQPEHELVDHLP 159 Enteroc...
Q3XXE3                83 YRSESRQDENACLAVLLNQKQYQIYLMYQHYKSEERYGSIAAYNQLLAILKEWSKTVD---IKDYYIWPQPEHELDDHLA 159 Enteroc...
WP_005470767          80 YRNEAHPNQNACLAALINQKQYQVYFMFQHYKSGQRSGSLAAYNDLRWQIEEWSKDKN---LADYYIWPQVEHELEDHCP 156 Enteroc...
Q82ZP4                83 YRSEQRQAENACLALLLNKKQFQVYLMFQHYKSEERTGSVVAYNQLLNRLEAWSQTID---CEGYYIWPQEEHELVDHLP 159 Enteroc...
Q74IK4               160 LAEYLSDYEKKTQFDQEAIKSSFLLGKFAFRDHDNVDNMEKFIIEGINDLIPLYEKL 216 Lactobacillus johnsonii
WP_003669458         160 LSKYLNNHDVQQQFNTEARQTSFLLGKFAFRGKDQVDDMEEYIDSAIRHLTPLYEEL 216 Lactobacillus reuteri
Q7DDA9               152 VAQQ-----NESDRKLQNDEDFFCIGKHIERDDLGRQDVAKWIAETVEDLLPLYEAC 203 Neisseria meningitidis serogro...
WP_015431718         152 VSEI-----DINSLILNHENDFFCIGKNIEKSQLNQIDGIDFIVKTIQDLAPLYDQC 203 Bibersteinia trehalosi
jgi:Asuc_0735        152 VKQM-----TPTDLNLRSDEDFWCIGKNVEKNDLAHIDAVEFIVRTLRELSPLYEKC 203 Actinobacillus succinogenes 130Z
P44013               154 VKVI-----SEKNLILRSDEDFWCIGKSIEKAELNQIDPVLFITHTIQQLQPLYDRC 205 Haemophilus influenzae Rd KW20
microsynth:EHR_03470 160 LATYLTDKQKQIELKKAMEHKTFQLGKLYFYPN-ELKDAEKLILDGMQELMPLYLRL 215 Enterococcus hirae ATCC 9790
Q3XXE3               160 LSDYLSDTKKQEELKKAMRDRTFQMGKLFFYPQ-EIEHVEQITAETLQELAPLYQKL 215 Enterococcus faecium DO
WP_005470767         157 LAVYLSEPQKQRQLEEKLQGRSFQIGKLWFPSE-SIEDVERLTTEALEELSPLYFsl 212 Enterococcus
Q82ZP4               160 LKDYLADEKQRKILEERIGNRSFQIGKLWFATE-KLETIEEKSCQALQELAPLYNAL 215 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap