Conserved Protein Domain Family
DSRB

?
pfam10781: DSRB 
Dextransucrase DSRB
DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose.
Statistics
?
PSSM-Id: 402421
View PSSM: pfam10781
Aligned: 7 rows
Threshold Bit Score: 113.337
Threshold Setting Gi: 455420468
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAR43494         1 MNVNDHVVVKTDGCEDRQGTILLIEEFNEGIMYLVSLPEYPNGIWFFNEKEGGEGTFVRP-V 61  Proteus mirabilis HI4320
CCH:MU9_1752     1 MQIDDTVYVKTDADEPREGRILLIEPFSEGVMYLVALPEYPEGIWFFNEKEGGDGVFITP-K 61  Morganella morganii subsp. morg...
Q8ZFN8           1 MKVNDRVTVKTDGGPRREGVVLEVEEFSEGVMYLVSLADYPAGVWFFNEVDSQDGTFVEP-L 61  Yersinia pestis
Q2NTL2           1 MKLHNRVTVKTDGGPRREGTILAVEEFSEGVMYLVSLDDYPTGIWFFNELSSPDGIFVEP-V 61  Sodalis glossinidius str. 'mors...
Q6D6J8           1 MKVNDLVTVKTDGKTRREGTILAVETFQEGIMYLVALEDYPAGIWFFNEVDSKDGTFVEL-K 61  Pectobacterium atrosepticum SCR...
IEC:ABF-0018766  1 MNVNDVVTVKTDGEVRREGVILAVEPFQEGTMYLIALEDYPEGIWFFNELSSPEGVFVEPrQ 62  Dickeya dadantii 3937
ACR69069         1 MQVNDRVSVKTDGGPRRIGRILALETFSEGTMYLVALDDYPQGIWFFNEAGCAQGIFVEPyd 62  Edwardsiella ictaluri 93-146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap