Conserved Protein Domain Family
XhlA

?
pfam10779: XhlA 
Haemolysin XhlA
XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.
Statistics
?
PSSM-Id: 402419
View PSSM: pfam10779
Aligned: 32 rows
Threshold Bit Score: 40.7285
Threshold Setting Gi: 508081524
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q03FI2                15 QKDVTTTKTKVENIEEklnQVDDIGKKAEKALAKSIEVEHEIGRITQIQNWVIGVLISGVLVTLVIYI 82  Pediococcus pentosa...
CDA11182               7 KETLERLERRINNHAQ---EIDKLKEDSAVLRTEIKNLCIDLKSLTATLKWFITALVGAFISFFFYAv 71  Clostridium bartlet...
WP_022747081           7 KDKLDTHERRLNNHSE---RIDKLEQDGRELKTELKNLCENLKSLTSMMKWFIATLVGALISFFFYAv 71  Clostridium sacchar...
goetting:CLSA_c35350   7 KDKIETHERRINNHGE---RLDKLEQDGRELKTEIKNLCENLKSLTNMIKWFITAIGGALISFFFYvv 71  Clostridium sacchar...
WP_015392798           7 KDKLERCETRLNNHGD---RLDKLEQDGRELKTELKNLCENLKNLTSMMKWFITAIGGALVSFFFYAv 71  Clostridium sacchar...
Q9KG67                26 VDRVERVEESQKESAT---RLNDLERNEALQDKDIKNLTVSLDKIQENTLWLRRTVTNAMITGSVGFF 90  Bacillus halodurans
Q8ETP0                13 QQDILEIENDIKKLKD---DVNKLQMNDAKQDEKIVNLQSTLASIQDDTKWIRRMITKAIVTAVITGI 77  Oceanobacillus ihey...
P39798                11 QQDLADMKGEHKALEQ---RVSALERVSDRQDQQIMTLNEKLNKIEENTTWIKRTITGAIITAVSTGI 75  Bacillus subtilis s...
Q65L09                11 QKEVQEMKADQKSLEQ---RVSTLERTSDRHDQQIISINEKLNKIEENTTWIKRSITGAIITAVSTGI 75  Bacillus lichenifor...
Q65KM9                11 KHEITELKADHKTLEQ---RVITLERASDRHDQQIMSINDKLNKIEENTTWIKRSITGAIITAVCTLV 75  Bacillus lichenifor...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap