Conserved Protein Domain Family
FliX

?
pfam10768: FliX 
Class II flagellar assembly regulator
The FliX protein is possibly a transient component of the flagellum that is required for the assembly process. FliX may contribute to the targeting or assembly of the P- and L-ring protein monomers at the cell pole. The family carries a potential N-terminal signal sequence and at least one transmembrane domain indicating that it might function either in or in association with the cell membrane.
Statistics
?
PSSM-Id: 402412
View PSSM: pfam10768
Aligned: 28 rows
Threshold Bit Score: 61.8841
Threshold Setting Gi: 146401452
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2RQF0          1 M-KIGGIRPGESAptRKSEKSGKAEKGV--FG---NHlrralDDEDDGEGGALEAASAIAGVGGLLALQEADsvdaSDPG 74  Rhodospirillum...
jgi:Hbal_0525   1 M-RVSRPVSNKPT--TGISKAKAAPKGG--FSnlvTSansgdGIEQTAPNAAAGGVAGVGGVESIMALQGVD-----NTA 70  Hirschia balti...
WP_012322439    1 M-RVETRQPIQSA--GGVASARKPEGGAa-FS---LGa----TPSSPTSAGAPAAAATLAGLDAVLLLQAEA----DTPQ 65  Methylobacterium
jgi:Mnod_4707   1 M-RVDPRFATAGP--GAVPKRPADASQS--FA---VA-----TGLPPRAAASAGSAAPLAGLDAILTLQAEA----EDPA 63  Methylobacteri...
jgi:Acry_0759   1 MtRVSGLRGSGPVggIGGRTGPAAAAGGg-FT----------ITTQSQQAAIAVAPVDMAG---LISLQDED-----GPV 61  Acidiphilium c...
Q89I02          1 M-RIYGPNGTTLG--TPASQARRTSSGT--FV---LP-----DTSSAQETRAAAAPKAAANIDALLALQGIE----EDPV 63  Bradyrhizobium...
MSU:OCAR_5381   1 M-RINGPHGTTFT--SSTSSARRSSGGG--FT---LD-----EMATTTETRAASAPRAAAGIDALLALQGIE----EDPT 63  Oligotropha ca...
CAL78745        1 M-RIYGPNGTTLN--TSTSSTRKTSSGG--FK---LP-----DAGTTQETRATLAPKQTANIDALLALQGIE----EEPA 63  Bradyrhizobium...
WP_014131030    1 M-RIDGTGRVIPA--NRSGTAAKSSGPT--FQ---IE-----SGQGSARTAQTSAPIAAGGIDALLALQAAD-----DAT 62  Pelagibacterium
WP_013652278    1 M-RITGNKPISAV--QSRSGKKRADGTTdgFV---PD-----LDGDSHPAASLTSGGAIHGIDSLLALQEVS-----VEP 64  Polymorphum gi...
Q2RQF0         75 ERRRRQARPGVTMLDELDRLRIAVIDGVVSKDDLIALARSTRSRRDANLDPQLGALLDEIELRVEVELAKL 145 Rhodospirillum rubrum A...
jgi:Hbal_0525  71 ERRNRAMRKGRRMMDALDRLQLSILDGHTSQSHLGLLQRALSEVREESGDDGLDNALGHVEVRTAVEIAKL 141 Hirschia baltica ATCC 4...
WP_012322439   66 ERRRRSAQRGQDLLDGLDRLKAALLGGRVAPQDLRAIAGRLNERAGLSGDPRLDGLMAEIELRAAVELAKL 136 Methylobacterium
jgi:Mnod_4707  64 ERRRRHARRGHDLLDALDRLKAALLGGRVSTADLKAIAGRLAERPGPTGDLRLDDLIGQIELRAEVELAKL 134 Methylobacterium nodula...
jgi:Acry_0759  62 RRDRAAHRAGEQTLGSLAALQAALLGG--ARPDLDTLRQMI-ENMPRPADPALQTVIGAIRLRARVELARH 129 Acidiphilium cryptum JF-5
Q89I02         64 ERRKRSVARGRTALDVLDDLKMGLLSGNLDASTVMRLRDAAANLKSSSGDPGLDSVLSEIELRVEVELAKA 134 Bradyrhizobium japonicum
MSU:OCAR_5381  64 ERRRRSVARGKNALDLLDDLKIGMLAGTLDPVMVNRLRGAASDLKTSSGDPGLDQVLSEIELRVEVEIAKA 134 Oligotropha carboxidovo...
CAL78745       64 ERRRRSVQRGKRALDVLDDLKLSLLSGRLDTTMALRLRDAAADLKQTSGDPGLDAILSEIELRVEVELAKS 134 Bradyrhizobium sp. ORS 278
WP_014131030   63 TGRRKALKRANSLLDVLEEIKADLLVGRMGEGRLNRAAALLAQAKTQI-EPELEAIVADIELRVRVELAKL 132 Pelagibacterium
WP_013652278   65 DSRDLAGRRGHTMLDSLDAMKADLLAGVVSPGRLEDLARQLAD-RQMSDDAGMEAVIDEIELRVRVELAKH 134 Polymorphum gilvum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap