Conserved Protein Domain Family
DUF2593

?
pfam10767: DUF2593 
Protein of unknown function (DUF2593)
This family of proteins appear to be restricted to Enterobacteriaceae. Some members in the family are annotated as YbjO however currently there is no known function.
Statistics
?
PSSM-Id: 402411
View PSSM: pfam10767
Aligned: 9 rows
Threshold Bit Score: 168.296
Threshold Setting Gi: 503082804
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
utah:Sant_2664       28 MIAGIALITIRCLDVVLLFNAFGVNGMHSFVSNSSRAWDLTGLFLASLTMVFIEIRCGFGVMRAVPWTRWCYLGCQMISA 107 Sodalis ...
goetting:EBL_c25520   1 MIAAIAIILTRCVDVVMLFNTLGWSGTQAFVLRSIQTWALTLISFASLLVVAVDVRCAFVIVRGRSWGRWLYLLVQLVVT 80  Shimwell...
P0AAZ0               26 QVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSVQTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAA 105 Escheric...
jgi:Rahaq2_2563      11 MIGASAIVATRLLEFVLLFDAMGFSGLMSFIEVSAESWLNCFLMLASLLIVLIECRAAYAMMRGRRWGRWAFIGCQVIVV 90  Rahnella...
WP_013317681          8 MVAGSAIIATRCLGIVLTISELGLSGFGGWLSSSAKQWDSTLVLLAALLVVCLEIRCGFAVLSGLNWGRWCFLLTQCLVT 87  Dickeya ...
Q6D3S1               13 MVAGIAIIATRFLGILLLVWELGLSDLSGWIGSNAEAWDSTLVLLLSLIIVGVEIRCGFAVLAGVNWGRWGYIACQGVVV 92  Pectobac...
WP_002208757         16 VIGGTAIIATRIIGVLLLVAELGFSGVSDFISDSLQRWDTGLIFFASIVLLLLDMMCGVAVCHRRNWARWYYLICQLIIM 95  Yersinia...
BAN95775             18 TIAGSAIIATRCISVLMLANELGYDEIANFVHRSAQAWDSTLIFIASQLIFLFELRCAFTLMRGSNAGRWGYVATQIVVL 97  Plautia ...
WP_013201496         23 LVAGIAAIATRVLGVALQVHDLGLAEVMSFVYRSAQAWNSTLIFIASQLIFFFELRCAVAMMHGKNWGRWGFVISQITVL 102 Erwinia ...
utah:Sant_2664      108 LYLFFATWRGFYPEMFMLPGDSAGQISYEVLMLKLPDLLIIALLFGAPSSRRFFAR 163 Sodalis praecaptivus
goetting:EBL_c25520  81 GYLWAASLGFGYPELFSIAGESKQEIFQALMAQKAPDFLVLFLLFIPPSSRRFFRL 136 Shimwellia blattae DSM 4481 = NB...
P0AAZ0              106 SYLWAASLGYGYPELFSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQL 161 Escherichia coli K-12
jgi:Rahaq2_2563      91 SYMLLASFDGFGPRIFRFNVETQGEFLYALLMQKIPDMLVLLLLYVPASSRRYFSR 146 Rahnella aquatilis CIP 78.65 = A...
WP_013317681         88 IYMLTASLVEFLPPIFHVSGDGVGEILHHLLMQRLPDFLLILLLFLPRRSQRFFTR 143 Dickeya dadantii
Q6D3S1               93 CYLLLASLSEFMPAIFHISGENHAAVLHQLLMQKIPDLLVIVLLFLPRRSKRFFLR 148 Pectobacterium atrosepticum
WP_002208757         96 IYLLMASLNWLEPDIFRIEGDSGAEILHSLLLQKIPDVVIIGLLFFP--WHRYFPQ 149 Yersinia pseudotuberculosis complex
BAN95775             98 LYMLMASVGWIYPEIFSIPGKNNAQIIHHTLLQKLPDVLVLVLLFVPASSRAFFRS 153 Plautia stali symbiont
WP_013201496        103 IYMFCASMGWIYPELFSVSGENNLQIIHLLISQKLPDLLIILLLFMPESSRRFFRQ 158 Erwinia billingiae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap