4C48


Conserved Protein Domain Family
AcrZ

?
pfam10766: AcrZ 
Click on image for an interactive view with Cn3D
Multidrug efflux pump-associated protein AcrZ
AcrZ is associated with the AcrA-TolC multidrug efflux pump, it may enhance the ability of the pump to recognize and export certain substrates.
Statistics
?
PSSM-Id: 371231
View PSSM: pfam10766
Aligned: 10 rows
Threshold Bit Score: 50.1032
Threshold Setting Gi: 488146083
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4C48_C                1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQ 44 
goetting:EBL_c26360   1 MLELIKSMVTAVIMVPIVMAVILGLIYGLGEVFNVLSGIGHRDT 44  Shimwellia blattae DSM 4481 = NBRC 105725
WP_002895156          1 MLELLKSLVFAVIMVPVVMAVILGLIYGLGEVFNLFSGVGHKDR 44  Gammaproteobacteria
WP_013317050          1 MLELLKSLLFAVCMVPVMMALILGAIYGLGEVFNLFSAIGHRES 44  Dickeya
jgi:Rahaq2_3144       1 MLELLESLIFAAIMVPVFIAVILGLIWGLGEVFNLISHVGHSKE 44  Rahnella aquatilis CIP 78.65 = ATCC 33071
CAX58859              1 MLELLIGLGEAILMVPVVMAIILGLIWGLGEVFNVISTIGHKKD 44  Erwinia billingiae Eb661
ACR70005              1 MFELLKSLVVAAIMVPVVMAIIMGLIWGMGELCNLISAWGHPEE 44  Edwardsiella ictaluri 93-146
utah:Sant_2742       56 MLELLESLAIVILMVPVVMAIILGLIYLLGELFNIISKFGQPKQ 99  Sodalis praecaptivus
BAN95620              1 M---LKSLAVAIIMAPIVMAIMLDLIYGLGEVFNVISKFGRRDD 41  Plautia stali symbiont
WP_002217291          1 MFELLKSLVFAVVMVPVVMAVILGLIYGLGEVFNVISKTGHPKE 44  Yersinia pseudotuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap