Conserved Protein Domain Family
YbaJ

?
pfam10757: YbaJ 
Biofilm formation regulator YbaJ
YbaJ regulates biofilm formation. It also has an important role in the regulation of motility in the biofilm. YbaJ functions in increasing conjugation, aggregation and decreasing the motility, resulting in an increase of biofilm
Statistics
?
PSSM-Id: 371226
View PSSM: pfam10757
Aligned: 6 rows
Threshold Bit Score: 182.676
Threshold Setting Gi: 498909835
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010845061     1 MDEYSPKRYDIAELKYLCEKLIHEALSVLNRADSHWIHDLTSEKSLKLNELIEHIAAFVWNFKIKYTDHYDLSTLIDEYL 80  Xenorhabdus n...
ACR68308         1 MDENTSYQHDISELKYLCDYLYHQGIDVLGESNHGWVSDPTAEVNLQLNELIEHIASIAQSFKIKYPRHSDLAEMLDYYL 80  Edwardsiella ...
P0AAR0           1 MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL 80  Escherichia c...
WP_013201058     1 MDEYSPKRHDIAQLKFVCENLYDESLATLGDSHHGWVNDPTAAVNLQLNDLIEHIAAFTMNYKIKHLEDSDLISQIDEYL 80  Erwinia
utah:Sant_2984   1 MDEYSPKRYDIAQLKYLCENLYDEGIASLGDSYHGWVNDPSSAVNLQLNELIEHIAANIVIFKLKYHNESELTDQVETFL 80  Sodalis praec...
Q6D809           1 MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL 80  Pectobacteriu...
WP_010845061    81 DETYNLFGSDKISFLELTKWQRTNEHLTNILLHD 114 Xenorhabdus nematophila
ACR68308        81 DETYALFGTYSISETALRQWLRTKRRMAYCLAHE 114 Edwardsiella ictaluri 93-146
P0AAR0          81 DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNA 114 Escherichia coli K-12
WP_013201058    81 DDTFMLFSNYGINVQDLQRWQKSAKRLFNIFAEE 114 Erwinia
utah:Sant_2984  81 DDTFTLFSSYGINNYDIQRWRRSRRRLFGTFSET 114 Sodalis praecaptivus
Q6D809          81 DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGE 114 Pectobacterium atrosepticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap