Conserved Protein Domain Family
DUF2585

?
pfam10755: DUF2585 
Protein of unknown function (DUF2585)
This family is conserved in Proteobacteria. The function is not known.
Statistics
?
PSSM-Id: 402403
View PSSM: pfam10755
Aligned: 15 rows
Threshold Bit Score: 230.32
Threshold Setting Gi: 47606263
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q89WN1          34 FAMGRVPICTCGYVKLWHGVVNSSENSQHIADWYSFSHVLHGFLFYGLTFLLFARLPllplsWPARLIVAMLIEGAWEIV 113 Bradyrhizobiu...
WP_012652708    34 YMMGRVPICTCGYVKLFEPVVNSSGNSQHIADWYTPSHIIHGFLFFGLTHLIMRRKP-----LSMRLFVAMLIESGWELL 108 Agrobacterium
Q8U527          32 YAMGRIPICECGYVKLFEPGVNTPGNSQHLADWYTPSHIIHGFLFYWFAWLLFRNKP-----FSMRLSFAVLIEAAWELL 106 Agrobacterium...
vbi:Avi_4194    33 HFMGRIWICSCGYVKLFEAGVNTPGNSQHLADWYTPSHIIHGFLFYGLGWLVLRRGS-----FGQRLTLATLIESGWELL 107 Agrobacterium...
P61415          37 FAMGRVPICTCGTVKLWHGVVMSSENSQHLTDWYTFSHIIHGFLFYAGTWLLLRRWP-----WTARLIVAVLIEGAWELT 111 Rhodopseudomo...
A6WX58          34 YFDGRIAMCECGTIKLWSGSLMT-ENSQHISDWYTLSHIIHGFLFYWLFTVIAPKAP-----LGLRLAAAVGIEAVWELV 107 Ochrobactrum ...
Q7UM18          40 AGMGRRFWCECGSWVPWSWDIWTAHNSQHLIDPYFFSHVLHGVLFYWALRWVPRl------nRTQCLLIALGLEASWEIL 113 Rhodopirellul...
Q2G7B5          30 LGMGRPPICPCGVVRLWHGVVESAENSQQVSDWYSFSHLIHGFLFYGAAHIVWRRFGfaelsPRWALALAVLIEGSWEIL 109 Novosphingobi...
Q1GNB5          25 IFMGRPPICPCGTVSLWHGTVQSNQNSQQISDWYSFSHIIHGFIFYGVLRWIMPERA-----LWVPLAIAIGTEGAWEIL 99  Sphingopyxis ...
ELS:G432_11660  34 LAMGRPPICTCGTIELWHGAVDA-GNSQHVADWYTPSHIVHGFLFYALGWLLLRRRP-----VGERLVLAVLIEAAWEVI 107 Sphingomonas ...
Q89WN1         114 ENSPFIIERYRAGTISLDYFGDSIVNSVSDNLAMVLGFLAARVLPVWVTVMIGLAFEIMLALHIRDNLTLNILMLIHPIE 193 Bradyrhizobiu...
WP_012652708   109 ENSPIIINRYRAATISLDYVGDSILNSAMDAVFMVVGFLFAWRAPVALTIAIAIFFELLTGWLIRDNLTLNVIMLVWPIE 188 Agrobacterium
Q8U527         107 ENSPIIIDRYRTATTALGYTGDSILNSAMDTVFMALGFLFAARVPVWLTVVIAIFFEIFTGWLIRDNLTLNVVMLVWPVD 186 Agrobacterium...
vbi:Avi_4194   108 ENSPVIINRYRAATMAVGYEGDSILNSAMDTVFMALGFLFAARVPVWLTIVVAVFFELLTGYLIRDNLTLNVIMLVWPVD 187 Agrobacterium...
P61415         112 ENSSFIIERYRAGTISLDYYGDSIVNSVADTLAMISGFLLARWLPVTATVAIAVLFEVLVGLHIRDNLTLNVIMLIHPFD 191 Rhodopseudomo...
A6WX58         108 ENSNFIIERYRANTSSVDYFGDSIVNSVADTVAALIGFLIAAKLPTKITVAIALFFEVLALIVIRDNLTLNVIMLLHPFE 187 Ochrobactrum ...
Q7UM18         114 ENSPLIIERYREATMAVGYTGDSIANSVTDVAACMLGYWFSSRFPWRWSVALFVVSEILMLIMIRDNLLLNVLMLVSPIP 193 Rhodopirellul...
Q2G7B5         110 ENSPIIIDRYRSVTISWGYSGDSVLNSAADIGFMAAGFLFAARAPVLVTVVLGIGFELFTLWAIRDNLALNILMLVWPVE 189 Novosphingobi...
Q1GNB5         100 ENSPLIIDRYREVTMAFGYSGDSVLNSVSDTLFMVAGFLAAGRMRWWVTAALAIAFELFTLWTIRDNLTLNVLMLVSPVE 179 Sphingopyxis ...
ELS:G432_11660 108 ENTPFVIDRYREATIALGYTGDSVLNSAADIGWMVLGFLLAWRLPVAATVALAVALELLALWVIRDNLTLNVLMLLWPIE 187 Sphingomonas ...
Q89WN1         194 AVKQWQSG 201 Bradyrhizobium diazoefficiens USDA 110
WP_012652708   189 AIKTWQGG 196 Agrobacterium
Q8U527         187 VIKEWQNA 194 Agrobacterium fabrum str. C58
vbi:Avi_4194   188 AIKAWQAA 195 Agrobacterium vitis S4
P61415         192 AIRQWQAG 199 Rhodopseudomonas palustris CGA009
A6WX58         188 FIKQWQSG 195 Ochrobactrum anthropi ATCC 49188
Q7UM18         194 AIQEWQSG 201 Rhodopirellula baltica SH 1
Q2G7B5         190 AVRVWQGG 197 Novosphingobium aromaticivorans DSM 12444
Q1GNB5         180 AIKDWQAG 187 Sphingopyxis alaskensis RB2256
ELS:G432_11660 188 AVRAWQGG 195 Sphingomonas sp. MM-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap