Conserved Protein Domain Family
Toxin_GhoT_OrtT

?
pfam10753: Toxin_GhoT_OrtT 
Toxin GhoT_OrtT
GhoT is part of the GhoT-GhoS type V toxin-antitoxin (TA) system. OrtT is homologous to GhoT, but it is not part of a TA pair. In this case, it acts as an independent toxin to reduce growth during stress related to amino acid and DNA synthesis.
Statistics
?
PSSM-Id: 402401
View PSSM: pfam10753
Aligned: 12 rows
Threshold Bit Score: 50.0179
Threshold Setting Gi: 488373603
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACR68928         6 WSFIKTAYGIGVLFCAFVTFFATKDpSMKIRLLSAIMVGLTWPMSFPLVLLFWLF 60  Edwardsiella ictaluri 93-146
jgi:Rahaq2_2536  5 WEVIKTIYWGGLGIAVLFTLLVSRD-TIKIRLLTSGIIGFTWPMSLPVVLLFSLF 58  Rahnella aquatilis CIP 78.65 = ATCC 33071
WP_025422635     5 WEALTHIYIIGLFIAVPVTFLLSHDpSLRIRLFTAKIIGLTWPMSLPVVLLFALF 59  Sodalis praecaptivus
IEC:ABF-0014530  7 WEMIRILYFLGLSVSTLFTFFMSKDnSLTMRFLASILIGVTWPLSFPVVIVFSFF 61  Dickeya dadantii 3937
Q6D6B4           7 WELIKLTYMIGFVVSLFVTFLLSKDkSLFIRFFASLIVGLTWPLSFPVVLLFSIF 61  Pectobacterium atrosepticum
WP_025422744     7 WQLIVASYLAGIAVTGFLTFFFSRDpSLGIRLLCSALIAVTWPLSFPLVLIF-IL 60  Sodalis praecaptivus
P64646           4 FSKILIFYVIGVNISFVIIWFISHE-KTHIRLLSAFLVGITWPMSLPVALLFSLF 57  Escherichia coli K-12
P64453           4 YQHMLVFYAVMAAIAFLITWFLSHD-KKRIRFLSAFLVGATWPMSFPVALLFSLF 57  Escherichia coli K-12
WP_002442988     4 YYKMLVFYAVMAVIFTIITWFLTKE-TLAIRLLAAFLVGATWPFSFPVALLFSLF 57  Shimwellia blattae
wugsc:KPN_01921  1 ---MLVFYAIMGVICAVISWFLTKE-SRMIRLLAALLIGATWPFSFPMALLVSLF 51  Klebsiella pneumoniae subsp. pneumonia...
CAR43558         4 iAIIGIGYLIGAVLSFIITFFLTKDpSLAMRLLSAFLIAITWPLSFPMAIIFSIF 58  Proteus mirabilis HI4320
CCH:MU9_2533     4 aQILLTIYATGGLLSFILTFFLTKDpNPFFRLLSCLLIALTWPMSLPVVILFSLF 58  Morganella morganii subsp. morganii KT
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap