Conserved Protein Domain Family
DUF2536

?
pfam10750: DUF2536 
Protein of unknown function (DUF2536)
This family of proteins with unknown function appears to be restricted to Bacillus spp. Structural modelling suggests this domain may bind nucleic acids.
Statistics
?
PSSM-Id: 371221
View PSSM: pfam10750
Aligned: 12 rows
Threshold Bit Score: 101.69
Threshold Setting Gi: 503253482
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
zhongguo:PM3016_5040  1 MDFILDKIETKIEFFEAWDLAALERLIDEAVNRNKALMLDVHSIGHQSVFHpLRGGMLYTAAVHFKIK 68  Paenibacillus mucila...
jgi:Bcoa_2712         1 MAFELDRIEDKIEFFEADRLEALEKKINDQIEANKTLLLRVASVSHQMQFD-ADGRPHYSAVVHFTAQ 67  Bacillus coagulans 36D1
O32030                1 MNFQLDLIKDKVEFFEAASLQELEKKINTQIENNKAIMLRVKSVSHQTLV--AEGRILYSAVVHFSAE 66  Bacillus subtilis su...
ABV63030              1 MDFQLDFLKDKIEFFEASSLKELEQKIQKQIEHNQAILLTVHSVSHQTTV--IDDRILYTAVVHFKAN 66  Bacillus pumilus SAF...
Q65GT7                1 MNFGLDLIKDKIEFFEALSLEELEKKISQQIENNQAILLRVHSVSHHTAV--IDGRIHYSAVVHFKAE 66  Bacillus licheniform...
WP_009796258          1 MNFQFDMIEDKVEFFEAEKLKDLEKKINDQIEVNKAILLTVHHVSHQMHVD-ENGRTYFSAVVLFKSK 67  Bacillus
Q5KWV7                2 pNISLDLIEDKIEFFEADDLRTLEKKINEQIEHNKALLLSVHHVSHQMHVM-ENGKRWYSAVVHFKAK 68  Geobacillus kaustoph...
WP_013488143          4 SS---NTLKDKVEFFEANDLSTLEKQIAKKIDDNQAIMLEVHHVSHEVTIEpKTGKKVYSAVVHFKgv 68  Bacillus cellulosily...
Q818A0                1 MSFTFEMLEDKVEFFEAGDLASLERKISEQIDNNKALMLEVHHISHQMVMDpESKRPYYSAVVHFKLK 68  Bacillus cereus ATCC...
Q9KDD5                1 MELKLELIQDKVECFEARDFNALEKAMNEQIEHNQALLLEVANVHHYVHLDpKTSQPVYTATVHFRAK 68  Bacillus halodurans
WP_012957988          1 MSIQLERIEDKVECFEATSFKELEQRINEKIDVNKALLLEVAQVNHHVYPHfKTGQPIYTAVVHFKAK 68  Bacillus pseudofirmus
WP_015845505          1 MEFRLDLIDDKVEFFEASDLRTLELKIEQQVENNKALLLQVHQVQHHAAFNaNTGKMLYSAVVHFKAK 68  Paenibacillus sp. JDR-2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap