4TPS


Conserved Protein Domain Family
SirA

?
pfam10747: SirA 
Click on image for an interactive view with Cn3D
Sporulation inhibitor of replication protein SirA
This entry represents the Sporulation inhibitor of replication (sirA) family of proteins from Bacillus sp. Induction of sporulation in rapidly growing cells inhibits replication; this is thought to be through the action of SirA protein and independent of phosphorylated Spo0A; however SirA protein synthesis is induced by Spo0A.
Statistics
?
PSSM-Id: 402398
View PSSM: pfam10747
Aligned: 14 rows
Threshold Bit Score: 160.875
Threshold Setting Gi: 81746332
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4TPS_C           9 RHYYTYLIKEEFANHYFGRESVMFELFQDYHWTSLEKQQyeMTEKQIQYITQPIPILHMHQRLKMNLN-KTDYRQLDYIY 87  Bacillus subt...
jgi:Bcell_2394   2 REYDIYIIKDHIANEYFGLEGKLFSLFQENRYANGRLKE--VTDMQIHFIKESINISKLDQLLYSRLHeKKGYAKEGNNH 79  Bacillus cell...
Q9KAD8           2 RQYELYLIVDEVARQYFGQESKLFHLFLEKEHATKVNEA--LIKKQIQYITEAIPTLHLQHVLHHLQPaGFTVEKTKTTF 79  Bacillus halo...
Q8EQM2           2 nAYSIYWIKEPVAKSYFHKSDLLHRFFNEYENDPERN----YLIKQFTFITQKFHLYKFAMHLKQFSSpNIYVKRIGNRI 77  Oceanobacillu...
WP_015863567     3 R-YWIYLLNEEVASYYRDRTEKIVGLLREHQCAKAPLKS--ICRKQVEFITERLSFSRLELGLKQYFAgSVGKNLERNMF 79  Bacillaceae
WP_012959285     2 RHYQLFLLEEDVAQHYFGQESKLFHLFLERTMASPEQKQ--IIDLQIEYISKPMPGLLLQQKMMAAFSnLSSYKVNKHIH 79  Bacillus pseu...
Q5WG07           2 RHYELYLLSDEVAASFSGKEAKLFQLFTERAKAKQSERH--IYDRQVDYITKPLPKAKLHEALQKRY----GLKKGNGYE 75  Bacillus clau...
WP_015593218     2 RSYHVYLIEDEFASHYYGREQMFYQLFLDKERSQGELKS--IIEKQIQYITKPIPSLRVHKNINQKLSkNKDFRFENGAY 79  Bacillus sp. ...
WP_022543749     2 RTYQLYLIEDEFASHYFGRERMFYQLFQEYSRSKGELKS--ILSRQIEFITRPIPALRLHQYLTQQLSrKKGASADQGAY 79  Bacillus
WP_014098218     2 RSYSIYLIKEEFAQYYYGRERMFFNLFHQYAHVSGSLKN--VLSRQIHYITKPIPLLSVHHVLQPLFSdTSNMTKTGACQ 79  Bacillus coag...
4TPS_C          88 RIALPKAKGHATFMMKEHMIEIVASGDYEAETIFFEVLRKVSPCFLAMDFNSKRYGWLNPVK 149 Bacillus subtilis subsp. subtil...
jgi:Bcell_2394  80 FIRLLNKKSQAGVYLDEHHITLFSEGTYDAEACFFEVLRHSNKCFIAMEFEEQRYGWLKPVR 141 Bacillus cellulosilyticus DSM 2522
Q9KAD8          80 RLYASRSESQAELFIQQDRLLLTSEGTIDAETTLFEALRKVRGAFFAIDVQRMRYGWLNPVR 141 Bacillus halodurans
Q8EQM2          78 QIKRD--QEVLFLYVENGGLSLRCSNLEAAVSILFPVLEDIHPYFFVQGQDNKHFGWISPMS 137 Oceanobacillus iheyensis
WP_015863567    80 ILKNEIGDE-ALLIVQKRRLLLVTDSSSIA-DDICRALAQISPSFLAVGADFDDYGWLTPLm 139 Bacillaceae
WP_012959285    80 VLDLAQPESCAELLIHKKHLSLTSTGEIEAETMFFEVLRKIDPCFFAINFETHRFGWLNPIK 141 Bacillus pseudofirmus
Q5WG07          76 LRSVFNERNRCLVELGDKSIQLEALGDLSAETTVFDVLKEVDSHFFAVNVADGRFGWLQPFE 137 Bacillus clausii KSM-K16
WP_015593218    80 YIERNGLFSAARLEITERFARVDSKGNFDSETIFFEALRQSEPSFLAIDLKHDRYGWLNPIK 141 Bacillus sp. 1NLA3E
WP_022543749    80 VIQNGK-NSSARLEIYDRCLVIESHGNYDAETVFFEILRKNESSYLAVDMTNRRFGWLKPIK 140 Bacillus
WP_014098218    80 LLSKKE-GQVLEVTIEERMLQLNVYGSYDTETAVFEILRNFKGDLLAIDYDHKRFGWIKPVK 140 Bacillus coagulans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap