4LHF


Conserved Protein Domain Family
Phage_Cox

?
pfam10743: Phage_Cox 
Click on image for an interactive view with Cn3D
Regulatory phage protein cox
This family of phage Cox proteins is expressed by Enterobacteria phages. The Cox protein is a 79-residue basic protein with a predicted strong helix-turn-helix DNA-binding motif. It inhibits integrative recombination and it activates site-specific excision of the HP1 genome from the Haemophilus influenzae chromosome, Hp1. Cox appears to function as a tetramer. Cox binding sites consist of two direct repeats of the consensus motif 5'-GGTMAWWWWA, one Cox tetramer binding to each motif. Cox binding interferes with the interaction of HP1 integrase with one of its binding sites, IBS5. This competition is central to directional control. Both Cox binding sites are needed for full inhibition of integration and for activating excision, because it plays a positive role in assembling the nucleoprotein complexes that produce excisive recombination, by inducing the formation of a critical conformation in those complexes.
Statistics
?
PSSM-Id: 371218
View PSSM: pfam10743
Aligned: 5 rows
Threshold Bit Score: 120.747
Threshold Setting Gi: 81644770
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LHF_A         1 MSKQVTLMTDAIPYQEFAKLIGKSTGAVRRMIDKGKLPVIDMTDPQsasGRAGEYWVYLPAWNNGLKLAYESRPKEIRDG 80  Escherichia vir...
WP_004237284   4 EIVKTPIASDCVTEAKFAEMIGKTKQAISDMRKDGKLPVVEMKDPK---GKRGEYYVYLPAWNAGLKLAYESLPEEMRDG 80  Morganella morg...
WP_012368213   4 EIEIHNIGSEFVTETKFAGYIGKTPKAVSDMRKDGKLPYVEVKHPD---NSRGEYYIDVTDWNKGLRMARKRMPKELRDG 80  Proteus
Q6D3V8        24 QIRLSEKPADLLSKEGFALYVGKTTSAIVAMAKAGKLPAFYMADPLkpgG-NAELWIHRLEWDKYAKQLVETAPPE---- 98  Pectobacterium ...
WP_015873444   6 YTGQYPV--EAVTIEKFAELIGKPETAVRKMITNNKLPVVELTDPEaaaARVGERWVVISEFNCIVREAYFNRPAKERGA 83  Candidatus Hami...
4LHF_A        81 WLMWLGL 87  Escherichia virus P2
WP_004237284  81 WLAWLGL 87  Morganella morganii
WP_012368213  81 WLIWLGm 87  Proteus
Q6D3V8        99 WHGWKDR 105 Pectobacterium atrosepticum
WP_015873444  84 WLKWLGL 90  Candidatus Hamiltonella defensa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap