Conserved Protein Domain Family
GerPC

?
pfam10737: GerPC 
Spore germination protein GerPC
GerPC is required for the formation of functionally normal spores. The gerP locus encodes a number of proteins which are thought to be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor.
Statistics
?
PSSM-Id: 371215
View PSSM: pfam10737
Aligned: 14 rows
Threshold Bit Score: 189.418
Threshold Setting Gi: 505405643
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015843865            31 IYSLEQQLAVLSEQLKQLENKPTYNIEKLEYHFDQLKVEKLEGTLNIGMTPPGMpgGdGDIEQLAV--QQHKPnvypaAA 108 Paeni...
BAH44782                23 IEHMRQMLEQLQQDVNDLKERQIPSVIKNEYKFDLLKVERLEGTLNIGLNPKGN--D-SGIGDFSI--NQSMD-----IP 92  Brevi...
tigr:GBAA_1147          23 ILNLEDQVRQLQEELNELKNRPSSSIGKVEYKFDQLKVENLNGTLNIGLNPFST--KeQQIEDFQVdtETLK------VN 94  Bacil...
O06719                  24 IQQLERQLKEIQTEMNTMKQRPATTIERVEYKFDQLKIERLDGTLNIGLNPTDP----NSVQNFDV--SQ-STpqigmMQ 96  Bacil...
MA:Aflv_2223            20 mQSLEQAVNALQQQYEQLKKKPHTTIEKIEYHFDQLKVETLEGTLNIGLNPATF--GeDTIENVAV--PKSQT-----II 90  Anoxy...
jgi:GWCH70_0677         47 IQSLEQRLLLLEKQLIELQQQPRTTIERIEYKFDQLKVETLEGTLNIGITPNGV--G-NTIEDFAV--QPEKT-----IV 116 Geoba...
Q5L257                  21 IRALERRLHALEARLREMEAQPRTSIERIEYKFDQLKVETLEGTLNIGIAPSGA--G-GTIEDFAV--EPVKT-----VI 90  Geoba...
WP_014095759            22 laKMEKTLASLIEEIEQLKARPPVRVDRIEYAFDQLKIETLDGTLNIGINPSDL----SSIEDAAIpkTQGIP------H 91  Bacil...
PRJNA212797:N288_07240  23 IKKLEKLAGELQQQLIALKDRPPIQVDTIEYKFDQLKVETLEGTLNIGLNPSEL----QGIEDFAVkgSNVSVp----AN 94  Bacil...
WP_015592745            23 IQYLEGLVTELKKELDELKKKPAICVDKIEYKFDQLKVESLAGTLNIGLNPSDL----QGIESFEV--PNGTGpstggVD 96  Bacil...
WP_015843865           109 PGITPPSEPYAGLRAEVDRFLSQHGNQRLIALETEYGVDLDPYHRRMVLEDIRKQLPSRIHFYMQlKpgeteagAAGQGQ 188 Paeni...
BAH44782                93 DPPQTSAPLFDRVQNEIYQYLEGDAYLVLEKIETECNYPLDQNYRAFILDDIKKQIDQRIKHYLN-D-------LPTDEL 164 Brevi...
tigr:GBAA_1147          95 PETDTNPDFYQGILQEMHRYLDEEAYNRILHFEKEERTPLDEMYRQMMVDDIKKQMEHRLPYYLS-Q-------AQSYEG 166 Bacil...
O06719                  97 Q--EESAQLMQQIRQNVDMYLTEEIPDILEQLENQYDSRLDDTNRHHVIEDIRKQMDSRIHYYMS-Hi------KKEENT 167 Bacil...
MA:Aflv_2223            91 P--QPTPI-FRNIQTAVHSYLQEEGENIIARIEQTYGRSLDPAYREFILQDIARQIDDRIHFYLR-Qy-----gEHEQAN 161 Anoxy...
jgi:GWCH70_0677        117 P--KPEPVLFRTIQEKVHAYLEKEAKETLKKLEEQYALRLDDTYRHFILQDIARQVDERIHFYLQ-QkmnngyvPASDND 193 Geoba...
Q5L257                  91 P--KPEPVLMRPIQEKVAAYLNGEASETLKRLEQQYGRRLDDTYRQFILQDIARQTDERIRFYLQ-EkanhgyvPSGDRD 167 Geoba...
WP_014095759            92 ANNEHRAALKQALTEKLMEYLEKELPTTITDNERQFKVRLNQEYHNFIKNDLKNQLPQRIDYYIN----------QLNST 161 Bacil...
PRJNA212797:N288_07240  95 PQGQMQRIV--EIEEDIEAFLEKDLPQVFAEAAAALDMEADSSYLSFIKEDVKKQLPSRVDYYVK-Q-------AQNNQQ 164 Bacil...
WP_015592745            97 PKNQFRNTM--EIEDEIYQHLETDLPQLIQNAETRVNRKLGEDYTDFIKEDIKKQIPARIQHYLQ---------HAPFRG 165 Bacil...
WP_015843865           189 NPQTEQeKKEMILSKTIRDADAAMQKYIQSL 219 Paenibacillus sp. JDR-2
BAH44782               165 EPEQHDiFVQTIVQKVKRDIDKTCETFVKNL 195 Brevibacillus brevis NBRC 100599
tigr:GBAA_1147         167 TSTDPDyLRDIIIQAMKHDIDKAFLSFIQHI 197 Bacillus anthracis str. 'Ames Ancestor'
O06719                 168 PPAQYA---EHIAEHVKRDVIRAVEHFLEHI 195 Bacillus subtilis subsp. subtilis str. 168
MA:Aflv_2223           162 DALQ-----QTIVSYLKRDIEHSIDTFLKHL 187 Anoxybacillus flavithermus WK1
jgi:GWCH70_0677        194 KSVE-----NEIFQKVKMDIEQSLDLFLKHL 219 Geobacillus sp. WCH70
Q5L257                 168 EAVE-----NEIFQKVKADIEQSLDAFLKHL 193 Geobacillus kaustophilus
WP_014095759           162 GPVEGE-WFDKLLGQIKADMAHAVQVFISHL 191 Bacillus coagulans
PRJNA212797:N288_07240 165 MARNPEgWWKEAASLIKGEIRNGVKAFLGNL 195 Bacillus infantis NRRL B-14911
WP_015592745           166 NEQEKEaWKQNIIGQILKEMENGICTFLTNL 196 Bacillus sp. 1NLA3E
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap