Conserved Protein Domain Family

pfam10736: DUF2527 
Protein of unknown function (DUF2627)
This family of proteins with unknown function appears to be restricted to a family of Enterobacterial proteins. It has a highly conserved sequence.
PSSM-Id: 119256
Aligned: 2 rows
Threshold Bit Score: 76.3298
Threshold Setting Gi: 54042844
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P64508                   1 MCGIFSKEVLSKHVDVEYRFSAEPYIGASCSNVSVLSM 38  Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap