Conserved Protein Domain Family
DUF2521

?
pfam10730: DUF2521 
Protein of unknown function (DUF2521)
Family of unknown function specific to Bacillus.
Statistics
?
PSSM-Id: 371213
View PSSM: pfam10730
Aligned: 13 rows
Threshold Bit Score: 192.109
Threshold Setting Gi: 81715481
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65P70              1 MGTVVSFNNEKQKKQINLEKQLLRELSLEKMLNSAEECFapl-fhFFSKHTDILYDGCIDFAIEAYLLGAEYGKFGYHGE 79  Bacillus l...
Q81VP7              1 MNVIVSLQEKQKEKQLKYERKMLRELSLKTLRSNIRDAF------QMQELHRQYEDYCIELGIESYLLGARYSKFGYYGE 74  Bacillus a...
ABV60842            1 MAEVLSFYQLKTKRDVTLEKKLLRTLSLQQVTDASEKFTkkl-fpFADDPAGIMSDGCIDFAIEAFLAGGRYGESSKYGE 79  Bacillus p...
P50862              1 MAEVLSFMDVKRQKDFELEKNLLKELSLRQIIQSVKDCLepl-fpFLHDERDIITEGCIDFAIEAYLLGGRFGIFGYYGE 79  Bacillus s...
Q9KG74              1 MTVITTFTQKRREKQWKFERKMLRELTLQQIKKDIQTHFqdi-ipFHFLTHPFLMDPCTDMAIDAYLLGAEFGRFGYYGE 79  Bacillus h...
Q5WLM1             18 MNVITTLTERRREKQWNFEKKMLRHISMKEMEKAIKEWMfpi-lpFQFQAYPFLIDQCLDMTIDAYLLGTEFGRFGYYGE 96  Bacillus c...
jgi:Bcell_0160      1 MNVVTDLGERRRRKQWKFERSMLRALSIEDMRKDVQEQFfdq-lvGQSVGKLYLVDYCLDIGIDAYLLGSEFGRFGYYGE 79  Bacillus c...
ADC49809            1 MAVVSTFSEKRREKQWKFERGVLRQLSLKQLKEDVHKHFkpv-vpFYFLSHPFLLDPCMDMAIDAYLVGAEYGRFGYLGE 79  Bacillus p...
Q5L3Q4              1 MTVITSLAEKRQEKQLRYERNMLRELSLEKLRTKALEHFvpf-ytAYRMFPSVVEEGCIDLAIEAYLLGARYSRFGYYGE 79  Geobacillu...
jgi:GWCH70_0146     1 MSVITSFKEKKQEKQMLYERKMLRELSFEKLKTKAIKHFspf-ypMYRAFPSVIEEGCIDIAIEAYLLGANYSRFGYYGE 79  Geobacillu...
WP_022543221        1 MSVITTFTDKQREKQIKYEKTVLKDISIKSLKESVKGHFgsirftSGLLMNTGVEEACYDVAIEAYLLGAHFSRFGYYGE 80  Bacillus
jgi:B1NLA3E_00735   1 MSLITTFKEKKREKQIKYERTLLRDLSIQMLKTSVQTHFgssritSGILMKSGMEEACYDIAIEGYLLGARMSRFGYFGE 80  Bacillus s...
jgi:Bcoa_1124       2 neVITTLSAKRRERQMKAERNLLRELPVEVLKKSFQSHFgsfrinGGAWMEQGIEEGCYDVAIEAYLLGGHYSRFGYYGE 81  Bacillus c...
Q65P70             80 PVHRAMIRSEKEEKQLLHELYEYAVSWSEAFNVQAAYEpLYYACEYFIQSWWKEGFSQRERRFKLRLR 147 Bacillus licheniformis...
Q81VP7             75 SFFDVKYRALEEEQQLTETLFQFLTSMTMREIKLQDEElLFESCQQFIGLWWQEGYEKGERRYRLKLH 142 Bacillus anthracis
ABV60842           80 SFDDIKKRSVHEENELVEELAGCLQSWGNMFRMERKMScLYPFAKDFLSMWWQEGFRESEKRHKLRLH 147 Bacillus pumilus SAFR-032
P50862             80 SMQSISARSAREEEELRMEFFDYLYNWIHEQYATFDKNtVYEAARKFIKDWWTAGFVQREKQCKLRMR 147 Bacillus subtilis subs...
Q9KG74             80 PAEKAKVRCEEELSDLSHYVFDLLQGWYTNSEFILDS--LHVASQAFVDHWWRKGFEEGTKRYKLRLH 145 Bacillus halodurans
Q5WLM1             97 PAQEARKRCEEELTDLSHCLCATLTGWSKEERAPTEA--LLAASDMLIGTWWEKGFREASKAYKLRLH 162 Bacillus clausii KSM-K16
jgi:Bcell_0160     80 TAEQAQHRCIEEINAYIEQTTGQFKSWFTLDEVETTI--QHEKSRAFILRWWNKGFAEGEKKYRLRLH 145 Bacillus cellulosilyti...
ADC49809           80 SVSEVMARCEDELTDISFSLFNLLQGWNGDTDYLLES--LKISSDVFIDRWWEKGFKEAEKRHRLRLH 145 Bacillus pseudofirmus OF4
Q5L3Q4             80 PAASVRCRCAQEEKYLIDTLFDFLCFWGNIDNDFLSQS-LYDACEQYIGNWWTEGFERGKKRRRLKLR 146 Geobacillus kaustophilus
jgi:GWCH70_0146    80 PAESVRRRCAQEEKYFIDTLFDFLCFWGNIDDGLANES-LYYACEHYVVYWWTEGFERGKKRRRLKLH 146 Geobacillus sp. WCH70
WP_022543221       81 GVEQVLERCRSEEKHFVDTLYNFLLYWGSGEEAAANES-LAGTCEHYVRHWWMEGFQKGQRRHKLRLH 147 Bacillus
jgi:B1NLA3E_00735  81 TASQVQMRCEQEMKHFIDTLYNFILYWGHGNEGIESES-LFYMCEQYVVSWWKEGFHKGERRYKLKLH 147 Bacillus sp. 1NLA3E
jgi:Bcoa_1124      82 PAEQAKKRCETELKHITDTLYNFWLYWTFGNDTMQES--IYYTCEQFADYFWSYGFKKGEQRRKLRLH 147 Bacillus coagulans 36D1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap