Conserved Protein Domain Family
DUF2518

?
pfam10726: DUF2518 
Protein of function (DUF2518)
This family is conserved in Cyanobacteria. Several members are annotated as the protein Ycf51. The function is not known.
Statistics
?
PSSM-Id: 402387
View PSSM: pfam10726
Aligned: 46 rows
Threshold Bit Score: 157.757
Threshold Setting Gi: 427344631
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015164548      6 PELFGQLAQGMGAFVLFCALISGIAFVRDWGWRFRMVGVTSFCVVLTVGLFALSLEP-FTTKEISGAAPYAIVYDRLGTE 84  Pseudanabaen...
Q31MA3            5 ATDFFAIAGWLGWATLALTILTVLAFVLGWGFRFRLVGVTAFTIVLIGGCIGFALGF-KQPVSIEGAAPFNVVYDAGGSE 83  Synechococcu...
jgi:Cyagr_0131    4 DPILFVAGTWLGAASGVLAVLTVAGFLARWGIRFRLVGITSFTALLSLSCLAFAISY-NPRVSVPGAIQVPVVFDNGTDL 82  Cyanobium gr...
WP_011935340      4 DPLLLKAGSWLAIAGGVLLVMTVLAFVMGWGVRFRLVGVSSFTLLLAAGCGAFAISY-SPRSSIEGALVVPVVFDNGSNL 82  Synechococcu...
WP_011932670      4 PELLDQSSGWLAWGGAALSALTIVAFIARWGLRFRLVGVSSFTLLLAASCWAFSVSY-TPTVKVDGALRVPVVFDNGDDL 82  Synechococcu...
Q46LW2            4 IEVIQDVTKWLAWVGAGLGVLTILAYLFNWGIKFRLTGTTIFTLLLSASCWAFEQSY-TPPFNVEGYKYAPIVYDNGFDL 82  Prochlorococ...
Q7V8C0            4 PELIETATGWLAWSGLALSLMTLIAFLVRWGQRFRLVGVTSFNLLLLASCWAFGVSY-TPPLKVEGALVVPVVFDNSTDL 82  Prochlorococ...
Q2JN17            6 ESFFASATQIGLGLAGLLAVLTLLAWIRNWPLKFALVGYTAFALVLTAGCFALSLGP-IFRSRIPGAAPYTTVYDQGADR 84  Synechococcu...
Q7ND20            2 gEFFTQVGNILGIVTILAAAVTLVAWLTKQKWRFRAFGTTAFLVVLTSGVWTLAILPsIVRPKVPGAEKFSIVFDRGANR 81  Gloeobacter ...
ASGPB:GKIL_2196   4 SGLFTTAGNILGIVTILCAVATLVSWLTKQPWRFRAFGVTAFLVVLTSGVWTLAILPsIVRQRIPGAEKFSVVFDRGGSR 83  Gloeobacter ...
WP_015164548     85 AVIKVQPEITADQLESTLEQAAFRLFTSGRGSDgGrSSQLRIRARTVLHPQPGVSQPLYLGEIKR 149 Pseudanabaena sp. PCC 7367
Q31MA3           84 AVVAVAPTIAPEAVEPTLKQAAFNLFSRGRYSSqG-EQQLHIRLRTILHPQPGISEPLYLGEVKR 147 Synechococcus elongatus PCC...
jgi:Cyagr_0131   83 VIAAAPANLGAEAVAPTLEQVARNLRGGGRGS----GGEVRVRLRRVEAVEPGLARPVVLAETTR 143 Cyanobium gracile PCC 6307
WP_011935340     83 VVAAAGADFPLEAAGPSAEQVASNLRGGGRNSS---DGLVHVRLRQLQAQSNGSSKPTVLAEATK 144 Synechococcus sp. RCC307
WP_011932670     83 VVAQAGIDFPPEAVAPTLEQLASNVRPGGRSS-----AVVSVRLRQLQPAGDGASKPVVLGELER 142 Synechococcus sp. WH 7803
Q46LW2           83 VVAQASNDFPKEAIKPTLLQIAGNLKGGGRNG-----AQVKVRLRKIESAGDGTSKPIILGELIN 142 Prochlorococcus marinus str...
Q7V8C0           83 VVAQVPDDFPDEAVEATLQQLAGNIHRGGYNG-----SEVHVRLRRLESVGEGVSQPVILGEVIR 142 Prochlorococcus marinus str...
Q2JN17           85 AVIAVSPDITPEQLILTLKQAASDLGSPGRFST-G-SPVFTLRARTVIHPEPGVSEPLLLGTLQQ 147 Synechococcus sp. JA-2-3B'a...
Q7ND20           82 AVIVVAPTITVAALATTLRQAAVDLRSTGRSLAgG--GTFLIQARTVVHPRPGVTRVLYVGSLER 144 Gloeobacter violaceus
ASGPB:GKIL_2196  84 AVIAVAATISLEALEKTLRQAAIDTGSSGRVIS---DRTFVLQARTIVHPRPGVSQIIPVGTLER 145 Gloeobacter kilaueensis JS1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap