Conserved Protein Domain Family
DUF2517

?
pfam10725: DUF2517 
Protein of unknown function (DUF2517)
This family is conserved in Proteobacteria. Several members are annotated as being protein YbfA. The function is not known.
Statistics
?
PSSM-Id: 402386
View PSSM: pfam10725
Aligned: 12 rows
Threshold Bit Score: 88.6079
Threshold Setting Gi: 291151741
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ADD76325         2 YRTYSRHKIILRRTLVILLGLLALPVMLFRKDRARFYSYLHRMWCKTSTKPVWLAQSEAA 61  Pantoea ananatis LMG 20103
WP_015872144     2 YQRYSWPRIWLRRCGVILVGTLAFPVMLLRHDRARFYSYLHRVWSKTSDKPVWLAESEKV 61  Edwardsiella ictaluri
WP_013201307     4 YQHYSLHRIVLRRIAVIVAGTLALPVMLFRQDRARFYSYLHRVWSKTSSQPVWLAQSEAA 63  Erwinia
WP_010848311     4 YREYSWHQVLLRRIGAVALGVIAFPVMLFRRDRARFYSYLHKVWLKTSDKPVWLECSEMA 63  Xenorhabdus nematophila
WP_004247539     4 YNEYTKKHVLARRTGAVALGIVAFPVMVFHPKRAQFYSYLHRVWSKTSNKPVWLAKSEMA 63  Proteus
CCH:MU9_1377     4 FQVYPLHKVLLRRTGAVSLGILAFPFMLFYRDRARFWSYLYRVWSKTSDKPVWLARSENA 63  Morganella morganii subsp. morgan...
Q7N6W4           4 YREYPWYQVLLRRIGAVTFGILAFPVMLFRRDRARFYSYLYRVWVKTSDKPVWLKQSEQV 63  Photorhabdus laumondii subsp. lau...
WP_002439297     6 YKRYSALHILLRRAFALTVGIAALPVMLFWKDRARFYSYLHRVWAKTGDKPVWMEQAEQA 65  Shimwellia blattae
IEC:ABF-0016966  4 YVVYPWYRVVLRRTAVVLVGIAALPVMLCWRGRSRFYSYLHRVWLKTSDKPVWLEQSEHA 63  Dickeya dadantii 3937
Q6D7I1           4 YTTYPLHRILLRRAAVIAIGVLALPVMLFRRDRARFYSYLHRVWLKTSDKPVWMAQSEAA 63  Pectobacterium atrosepticum
WP_015698128     4 YTPYTMTRILARRAFVIAAGILALPVMLFRADRARFNSYLHRVWMKTSDKPVWLSHAEMA 63  Rahnella aquatilis
WP_011706879     2 FHPYSLTQIILRRIYVLLVGMLAFPVMLFRSDRARFYSYLHRIWNKTSTKPVWLKMSERG 61  Aeromonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap