3M92


Conserved Protein Domain Family
DUF2498

?
pfam10692: DUF2498 
Protein of unknown function (DUF2498)
Members of this family are Gammaproteobacteria. Many are annotated as like E coli protein YciN. The function is not known.
Statistics
?
PSSM-Id: 402364
View PSSM: pfam10692
Aligned: 18 rows
Threshold Bit Score: 139.782
Threshold Setting Gi: 491440794
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3M92_A           26 ETQPIDRETLLKEANKIIREHEDTLAGIEATGVTQRNGVLVFTGDYFLDEQGLPTAKSTAVFNXFKHLAHVLSEKYHLV 104
WP_013202387      3 QTQTIDRPALLVIANELIAGHKDVFPGLVATDVEQKGDVLIFRGDYFLDEQGLPGEKSTVVFNVFKYLAVELSPLYRIa 81  Erwinia
jgi:Tola_1132     3 TKQPINKVSLLELANHIMQEHDDYLAGMAVTDVTEKSGVLVFKGEYFLDEQGLPTPKTTAVFNVYKGLAQVLSLQYTLe 81  Tolumonas aue...
Q9KRB1            3 HKKPITEFELLLIANQLIQDHECYIEGMRATQVEEKEGVLVFKGEYFLTEQGLPTEKTTAVFNMFKYLAHHLSPEFTLQ 81  Vibrio cholerae
Q6LPB6            3 DKKSIPQDSLLLIANQLIQDHDAYITGMRATSVEEKSDVLVFKGEYFLDDNGLPTTNTTAVFNMFKYLAHKLSPEFTLQ 81  Photobacteriu...
CAV18187          2 TKKVIAEFDLLLIANQIIQSHDDYIEGMRANSVVEKDDVLIFKGEYFLDNNGMPTENTTAVFNMFKYLAHHLSKEFTIQ 80  Vibrio tasman...
Q6D4V3           10 EKRPISRQSLLVEANDIIKHHDDYLHGMVADSVEQKNGVLVFRGEFFLDENGIPTLKSTAVFNMFKHLAHVLSEKYYLV 88  Pectobacteriu...
IEC:ABF-0015546  16 EKTPIGREALLLEANALIKNHEDYLHGMVANAVDQKNGVLVFRGEYFLDDDGLPTHKTTAVFNMFKHLAHVLSEKYQLI 94  Dickeya dadan...
ACR68889          4 ETTPITREQLLAEANQIIRDHEDYMKGMIATDVEQKGNVLVFRGEFFLDEEGLPTPKSTAAFNMFKHLAHRLSEKYHLA 82  Edwardsiella ...
WP_016606777      2 NTTPIERSKLLAEANEIIRQHEDYLHGMHATDVEQKGPVLVFRGEYFLDAEGLPTAKTTAVFNMFKHLAHVLSAKYHLI 80  Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap