6DWW


Conserved Protein Domain Family
DBD_Tnp_Hermes

?
pfam10683: DBD_Tnp_Hermes 
Click on image for an interactive view with Cn3D
Hermes transposase DNA-binding domain
This domain confers specific DNA-binding on Hermes transposase.
Statistics
?
PSSM-Id: 402358
View PSSM: pfam10683
Aligned: 4 rows
Threshold Bit Score: 125.345
Threshold Setting Gi: 74875269
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6DWW_A   5 SRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELLPSPIT 71  house fly
Q6IKK0 255 PTELKIVSEIDREEAIEKCTQWVVQDRQSFSAVTGAGFKNLVQFFLKIGAVYGDQVDVDDLLPDPTT 321 fruit fly
Q8T636 128 PSELIIVSENDKKVAIEKCTQWVVRDCPPFSAVTGAGFKKKVKFFLQIGAIYGEQVDVDDLLPDPPT 194 cabbage moth
O96691  79 SQELRTVTVEDKNEAVKKFTSWVVEDCRPFSVVQGSGFIKLVKFFIKIGASYGEHVDVEDLLPSATT 145 Bactrocera tryoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap