Conserved Protein Domain Family
DUF2483

?
pfam10656: DUF2483 
Hypothetical protein of unknown function (DUF2483)
This is a family of proteins found in bacteriophage particularly of the SA bacteriophages 11, Mu50B, family, homologous to phi-ETA orf16.
Statistics
?
PSSM-Id: 371183
View PSSM: pfam10656
Aligned: 2 rows
Threshold Bit Score: 113.726
Threshold Setting Gi: 122539040
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2FWQ8  1 MKQTVTYLIKHKDENLFITNRPTEVNDTVKYSTDMRDAREFDGLDKTVIDMSKHKAIKKTVTETIEYEKVEH 72  Staphylococcus aureus subsp. a...
Q2FWQ8  1 MKQTVTYLIKHKDENLFITNRPTEVNDTVKYSTDMRDAREFDGLDKTVIDMSKHKAIKKTVTETIEYEKVEH 72  Staphylococcus aureus subsp. a...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap