Conserved Protein Domain Family
DUF2476

?
pfam10630: DUF2476 
Protein of unknown function (DUF2476)
This is a family of proteins of unknown function. The family is rich in proline residues.
Statistics
?
PSSM-Id: 402321
View PSSM: pfam10630
Aligned: 18 rows
Threshold Bit Score: 186.518
Threshold Setting Gi: 344244356
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003789481   2 GRRPRSPSAGHAPWWGPQPGGPGPAKRPRLE-KEPVL--ELSAGSSLEDSAGTPAADVLTSVVVLAAGCALQVPLDDVDL 78  small-eared galago
XP_873843      2 GSRPHSSSASSADQWEQQAEGPGPAKRRRTE-EPTDH--EFEVAPRVDNVMGTPDMGALTSLVILADGYALHLPLDDVDL 78  cattle
XP_027406887   2 GSRPRSPGAYASDRWGNQAGETSPAKRRRTE-ERARPesESETAPSMDNLTGPTAAGALTRVLVLPAGCALHLPLDDVDL 80  hybrid cattle
1_pfamImport   2 GSRPRGPNASPAAWWVPQVRVSGLDKRGQTE-EPASPesKSEAVPGPRQPDLAPH-----HMVVLPTSYTLPVLIDNIDL 75 
XP_012011665   2 GCPPRSPTAYPEDPWEPQDGGPGPAKRPKSE---------SEAAPSLDNLAWSPTAGTLIFMAVLPAGCALHVLLDDVEL 72  mouflon
XP_003420004   2 DSRPRSPSPCPAPWGVLQTGGPRPAKRLRWE--------EPEVQPGQSGT-----AGDLTSVVVLAAGCALQVPLRDADL 68  African savanna...
EGW00462     315 QKRPRSPSPESAPCWASQPQGPSSAKRLCLH-EPARN--EPPGLPNVQVPAPAAS-EVLISVVVL------------LDL 378 Chinese hamster
EGW00463     318 HKRPISLSPEQVPCWAPQPQGHSSAKRCRLH-EPARN--DPPMPTDMEALTPG---EEHIFLVVL------------LHL 379 Chinese hamster
EGW00464     464 QKRPRSPSPEPAPCKAPQPQGPSSAKRRRLH-EPARN--EPPMPTNLEAITPAAS-EEIISMVVL------------LDL 527 Chinese hamster
Q9CWP9         3 RTRPRSPSADPAPCWSPQTPAPSPAKRRRLHqEPACP--EPLAQPELEAPAEPT-----TSVVFLAAGSALQLPLDGVDL 75  house mouse
XP_003789481  79 VLEPEPTSVLQVSFEGHTLILVPEV----LLgLVKECSGGQGDSS-VGLEPGVFVGAPG-EEIVLEQPFFLTSVSEIAAQ 152 small-eared galago
XP_873843     79 VLEPEPTSVLQVSLGDNTLILVPGA----LL----EFLEGESHSA-LGLEQGSFLNAPG-ECVALEQG-FYGPVPEIAGQ 147 cattle
XP_027406887  81 VLEPEPTSVLQVALGDFILTLVPEA----LLsSRVEGPSGQV------LERAALLSPPR-EYTALEPG-FCAAVPEVACE 148 hybrid cattle
1_pfamImport  76 LLGPEPTSVRQVSWRSH-----PHAglkiLLgLAVEGPWGQG------LEQGAFLSAPW-KFMVLAPGFFCTAVPEVACQ 143
XP_012011665  73 LLEPEPTSVRQVCLGGRILMLVPEA----LLgSGVEGPWGQG------LEPGAVLSPPG-EYVALEPGLSCAAVPEIACQ 141 mouflon
XP_003420004  69 VLEPAPASVLRVSLGNHTLILVHEA----LLdPVVEDSRGESDSS-VSLELGSFLTVLG-DDIAVEQGSFCTSTSETAAH 142 African savanna...
EGW00462     379 LLESQPISVMQVQLPGHTLILVPEG-------PPLSAPLGQPEISsTSPQEAALLQMPQdQLVVLPAEF----ILEISYQ 447 Chinese hamster
EGW00463     380 VLKPQPTSVKQVELPGFTLNLGHEG-------LPLSDPLGQPEISsTRPQEAALLQTPQdQLVIPPAEF----IPEISFL 448 Chinese hamster
EGW00464     528 VLESHPTSVKQVELHGFTLILVPED-------LPLSAPLGQPEISsTRPQEDALLQTPQdQLVVLPTEF----SLEISYQ 596 Chinese hamster
Q9CWP9        76 LLEPEPTSVLQVSLQGHTILLVPEG-------LQDSTHFGQPGFVaISPQGAAAQDGPQdHLVGLQEETFC----EYFYQ 144 house mouse
XP_003789481 153 KGAF--HEDTEPYVLEPWMEPPAGSAAGLQPSARKVSSPYPLGPVPE-PAPLVLSPSPGRRSPNPMFDLEFHLLEPFPSS 229 small-eared galago
XP_873843    148 EEVY--QEDADTVFPPAGMNAAASSVAGLLLSPRRASDPDFVGLAPE-PWPQAPNPTPERGSPHHQDNLDLHVPEFFPDS 224 cattle
XP_027406887 149 EETNgdDADSGSDFLSPEMDPAGGLIAGVRSPDARVWRSDAQGFFPE-FWPRAPNPSPERCSPHHDDHLDMHLLEPFPDS 227 hybrid cattle
1_pfamImport 144 EEAK--RRAGPGNFMRSGMDAAYILVAGLLLLAGSVLVLTCRAACLErPSPTSPG-----------DNLNFGLLESFPDS 210
XP_012011665 142 GEASeeDANADADFLLGWMDAASDPVAELRCSAESLTHFDLFDVVSE-PSPRASNPSPERGSPQHDDHLDLHLLEPFPDS 220 mouflon
XP_003420004 143 A-----EEDANLEFLQLWNDSQAILVAGLRPSARGVPGPSPRGPIPE-PSPWVPS-------------LDSHLLGAFPSS 203 African savanna...
EGW00462     448 EDAC--DEDQNSGFMTPWIGAPPGEASELFSNTNGMSSPWTPDYNLE-PQL----PVLSSNAARNIWDLDSYLLGSFPTS 520 Chinese hamster
EGW00463     449 EDTC--DEDQNSGFMTPWIGAPPGEASELFSNTNGMSSPWTPDYNLE-PQL----QVLSSNAARNIWELDCYLLGPFPTS 521 Chinese hamster
EGW00464     597 EDAC--DEDQNSGFMIPWIGAPPGEASELFSSTKRMSSPWTPDYNLE-PQL----PVLSSNAARNIWELDSYLLGPFPTS 669 Chinese hamster
Q9CWP9       145 EDVC--DEDADLEFLEHWASPPDDQANGNFSSIPGVPSPLSQDQVPG-PS-----TGAEQYSPRFIWELDINMLGPFPGS 216 house mouse
XP_003789481 230 PLQPLPPSPNPGShHTRSEgavRSPRPP------------CKARRSL 264 small-eared galago
XP_873843    225 PLQPLPPSPCPGS-HERPQ---HPPVPA------------RKAQRRL 255 cattle
XP_027406887 228 PLQSLPPSPSPSP-HERPP---RPHGPA------------PKARRCL 258 hybrid cattle
1_pfamImport 211 PLQSLPPSWSPSP-HQRPR---GPHGPP------------HKTWK-- 239
XP_012011665 221 PLQPLPPSPSPGP-QERPC---RPPGPP------------CKARRCL 251 mouflon
XP_003420004 204 PLQPLPPSPSPSP-HERPQ---RSPRPP------------CRARRRL 234 African savanna elephant
EGW00462     521 PLQPLPPSPPPSPqGQRPA---CPTRPSrsl------rapCKARRRL 558 Chinese hamster
EGW00463     522 PLQPLPPSPPPSPqGQRPA---HPAGPSrstrparpprvsCKVRRRL 565 Chinese hamster
EGW00464     670 PLQPLPPSPPPSPqEQRPA---RPAGPSpa---------lCKAKRRL 704 Chinese hamster
Q9CWP9       217 PLQPLPPSPSRNPqEQLPPcppCSPRAP------------RRARKRL 251 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap