4LCT


Conserved Protein Domain Family
RPN7

?
pfam10602: RPN7 
Click on image for an interactive view with Cn3D
26S proteasome subunit RPN7
RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins.
Statistics
?
PSSM-Id: 402301
View PSSM: pfam10602
Aligned: 56 rows
Threshold Bit Score: 114.599
Threshold Setting Gi: 159107706
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LCT_C        73 DLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIR-TRDYCTTTKHIIHMCMNA 151 thale cress
O94308        77 DVEWVESVTFHRKQNLEQLRRELKAYKNNLIRESIRAAQLDLASFFADVGQFDSALRSYAK-VREYCTNAGQIAHLSLEL 155 Schizosaccharom...
EAW15172     120 DTKWVDHMQKVVKAETDRLEHELRGYKNNLIKESIRMGNEDLGQHYHQIGNLVAASKAYSR-MRDYCTTPSHIASMLFKI 198 Aspergillus cla...
XP_001542604  41 KVVRVE-------AKGFILVQSRQSSIWSPISAIIKMGNEDLGHHYHLIGDLPSASKAYSR-MREYCTTTSHIGSMLFRN 112 Histoplasma cap...
EDN97703      80 DDQWIDATNKSNAAEAARLEAQLKGYKNNLIKESTRMGNEDLGKHYEATGQLALAFDAYSR-MRQDISIPRHVIDVCKHI 158 Sclerotinia scl...
Q2HA08        86 DQDWLQAREEENKVETNRLLKELKGYKNNLIKESIRMGNEDLAKHLESIGDLNAASETFSK-MRPDVSTAKQLIDVSKHL 164 Chaetomium glob...
Q7RXQ1        80 DKAWMESKEKENRDTTAHLQAELQGYKNNLIKESIRMGNEDLGKHFEAIGDVEAAMDSFWK-MRTEVSSTEQLVDLGKLL 158 Neurospora cras...
Q9GS00       163 DQKWIEENGATWQSTTDQLQAEYKRHKDEGVKESTRRAMEDLFQHYMMAGKIDEAIRLYSRgIRDYCTQLKHSINMWINW 242 Caenorhabditis ...
XP_002638604 160 DTKWVDETSGSWQVALDHLQIEYKRHKDEGVKESTRRAMEDLFRHFLVAGKTEEAIRLYSRgIRDYCTQLKHSINMWMNW 239 Caenorhabditis ...
Q5KHC7       133 DERWINETRDTVAKEVSRLDVELRGYMSNLIKESIRLTQLAFAELAFKVGKVREALNYYAA-TREYSSTPQHHVDLGVGV 211 Cryptococcus ne...
4LCT_C       152 ILVSIEMGQFTHVTSYVNKAEQNPETLE-----------------------------------------PMVNAKLRCAS 190 thale cress
O94308       156 MRISIWIGNYSHVLAFGSRAKSTVSAA------------------------------------------MELTSPIYAYC 193 Schizosaccharom...
EAW15172     199 INVAIERGDWLSVQSNVHRLRNLQSKPEe---------------------------------------qAKNQPKMSAAL 239 Aspergillus cla...
XP_001542604 113 IHVAIDRGDWLGVQSNVQRLRNLQFKPEd---------------------------------------eAKNKAKMFAAL 153 Histoplasma cap...
EDN97703     159 IEVSIERKEYIAVLSNVQKMRGTSVGPYd---------------------------------------dQDVKPFCHVAE 199 Sclerotinia scl...
Q2HA08       165 VRVCIQRREWDMVSAHLSKIGGAQSADEe----------------------------------------KAVQPYLKIAY 204 Chaetomium glob...
Q7RXQ1       159 VRVAIERRDWKSIGNHLKPLNSVNDSDPk---------------------------------------aKALKTYSKIAN 199 Neurospora cras...
Q9GS00       243 MEVAICANDWGKLDTVTNTAYRSLKDADdaeknsqqsqqappqrgenapymverdpnapiqtltnrqliETALAKCLAAQ 322 Caenorhabditis ...
XP_002638604 240 IEVSICGNDWGKLESITSTAFRSLKDADdaeknnqqqqrgenaty-------lvnqsapmtspsnrqliETALAKCQAAQ 312 Caenorhabditis ...
Q5KHC7       212 VETCLAFNYPAPLSGHIAKLETTLDRLHppphtqskqqaglstta-------sdlrerqaeesrsqaarRSVMVRAKVGK 284 Cryptococcus ne...
4LCT_C       191 GLAHLELKKYKLAARKFLDVNPELGns---yNEVIAPQDIATYGGLCALASFDRSELKQK 247 thale cress
O94308       194 GLANFCLGDYEEALAHFLKVETDTS------DGIITKTDISVYISLCALACWDHKRLIQE 247 Schizosaccharomyces pombe 972h-
EAW15172     240 GLSQLHSGSYLEAANCFLSTDPSLGds---yNEVLTSNDVAVYGGLCALASMDRNELQRR 296 Aspergillus clavatus NRRL 1
XP_001542604 154 GLSQLASSAYHSAAINFLSTDPILAdn---yKEVISANDIAVYGGLCALASMDRADLQTH 210 Histoplasma capsulatum NAm1
EDN97703     200 GIAQMHAGQYAMAAQTFLQVPPGFAgs---yYTIVTANDVAVYGGLCALATIERNDLQKL 256 Sclerotinia sclerotiorum 1980 UF-70
Q2HA08       205 GIAFLGRGRFKDAALSFLSADSSIPss--tyGELASQSDVAIYGGLLALASMDRAELQST 262 Chaetomium globosum CBS 148.51
Q7RXQ1       200 GIAALGQERYKEAAFCFVEASSGVPpe--iyNQIASPNDVAIYGGLLALATMDRHELQAN 257 Neurospora crassa OR74A
Q9GS00       323 VLLKLRNKRYSQVVETILQIKTEClq----sKWFVTSSDLGIYGMLSAMATMSRADLKLQ 378 Caenorhabditis elegans
XP_002638604 313 VILKLRNHRYSDVLETVLVIKTECld----sKWYVTSSDLGIYSVLCAMATLGRTNLKKL 368 Caenorhabditis briggsae
Q5KHC7       285 GLISASQKDWARAGRELGWIEEDEGglgdweGKAISTSDLALLSAFYVLASSDRSRIRRV 344 Cryptococcus neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap