Conserved Protein Domain Family
U5_2-snRNA_bdg

?
pfam10597: U5_2-snRNA_bdg 
U5-snRNA binding site 2 of PrP8
The essential spliceosomal protein Prp8 interacts with U5 and U6 snRNAs and with specific pre-mRNA sequences that participate in catalysis. This close association with crucial RNA sequences, together with extensive genetic evidence, suggests that Prp8 could directly affect the function of the catalytic core, perhaps acting as a splicing cofactor.
Statistics
?
PSSM-Id: 402297
View PSSM: pfam10597
Aligned: 17 rows
Threshold Bit Score: 240.359
Threshold Setting Gi: 122100756
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6CXV6                   1283 DEGVWDLVLDSTKERTAKAFLQVSQEAIDEFRGRIQSILMGSGSTTFTKIVGKWNTALIALFTYFRESIVTTEPLLDLLV 1362 K...
CCD23994                 1283 DEGVWDLINEATKQRTAKAFLKVSEEEITNFESRINGILMAAGSSTFTKIAAKWNTALISLFTYFREATVSSERLLDVLV 1362 N...
Q6FQZ4                   1283 SESVWDLVEKSTQQRTAIAYLKVSQESIDIFEGVIRGILMTAGSATFSKIAAKWNTALIALFTYFREAIITTEPLLDILV 1362 [...
XP_001525158               95 QENTWDLIDLSTNERTARAHLQVSEESMDHFRNRIRQILMSSGSSPFTKVAAKWNTALIALVTYFREAAVATPALLELLI 174  L...
Q38DR4                   1269 NESTWNLQNTTTRDVTARAFLQVSPDDVNNIRNKARRAIMMVGSSTFQSIAAKWNALVTEIVPYYREAILGTDSLQQVLA 1348 T...
XP_013022322             1230 RDGVWNLSNNLTKERTAQAFIRVTDEDIKKFSNRIRQILMSSGSTTFTKIANKWNTALIALMTYYREAAISTPELLDVLV 1309 S...
XP_009267084             1213 NDGVWNLTNEATKERTAQAYLRVSDDGINAFNNRIRQVLMSSGSTTFSKIINKWNTTIIGLMTYYREAVLHTNELLDSLV 1292 W...
XP_001330664             1200 QEGTWVLQNEITHETTAFVFLRVSEKSITYFRNRVRTILLSSQATTFMKVSNKWNTAIIALVVYFREALVATPELIDEIV 1279 T...
WGS:AAFB:cds.EHI_060350A 1153 KEDAWALTNNETMEKTANAYLKVSKEEIMKFDNRIRQILMSSSATTFTRVVNKWNTALIGLMMYFREATIHTQELLDVLV 1232 E...
XP_023303063             1270 RDGVWNLQNEVTKERTAQCFLRVDDESLGRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLV 1349 A...
Q6CXV6                   1363 KSETRVQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMLSASHILIPASDLRWS 1416 Kluyveromyces lactis
CCD23994                 1363 KAETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMLSASHILIPASDLNYS 1416 Naumovozyma dairenensis CBS...
Q6FQZ4                   1363 KSETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMLSASHILIPSSDLAYS 1416 [Candida] glabrata
XP_001525158              175 KCETKVQNRVKMGLNSKMPARFPPAVFYTPKELGGLGMLSASHVLVPEADLKWS 228  Lodderomyces elongisporus N...
Q38DR4                   1349 RAEHRMQSRIMMALNSRAKARFPPVIFYAPTDLGGLGMLSVGHSLIPARDLVYS 1402 Trypanosoma brucei
XP_013022322             1310 KCESKVQTRVKISLNSKMPSRFPPAVFYSPKELGGLGMLSMGHVLIPQSDLRWS 1363 Schizosaccharomyces cryophi...
XP_009267084             1293 KAENKVQTRVKIGLNSKMPSRFPPVVFYSPKELGGLGMLSMGHVLIPQSDLRWS 1346 Wallemia ichthyophaga EXF-994
XP_001330664             1280 KCENRVQTRVKLGLNSKMPNRFPPVVFYAPKEFGGLGLISMGHVLIPQSDLRYa 1333 Trichomonas vaginalis G3
WGS:AAFB:cds.EHI_060350A 1233 KCENKIQTRIKIGLNSKMPNRFPPVVFYTPKELGGLGMLSMGHVLIPQSDFKWS 1286 Entamoeba histolytica HM-1:...
XP_023303063             1350 KCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWS 1403 Australian sheep blowfly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap