Conserved Protein Domain Family
Involucrin_N

?
pfam10583: Involucrin_N 
Involucrin of squamous epithelia N-terminus
This is the N-terminal three beta strands of involucrin, a protein present in keratinocytes of epidermis and other stratified squamous epithelia. Involucrin first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane. Apigenin is a plant-derived flavanoid that has significant promise as a skin cancer chemopreventive agent. It has been found that apigenin regulates normal human keratinocyte differentiation by suppressing it and this is associated with reduced cell proliferation without apoptosis. The downstream part of the protein is represented by the family Involucrin, pfam00904.
Statistics
?
PSSM-Id: 402286
View PSSM: pfam10583
Aligned: 9 rows
Threshold Bit Score: 74.9116
Threshold Setting Gi: 1537967852
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003803978   1 MSQQHTLPVTLPPALRQELLGTLSPPAAAQQEQRKPPTPLPTACQKVGSELPGEVPSKHEEKGTDPVKG 69  small-eared galago
XP_008262643   1 MSEQHTLPVTLPPALCQEILKTVPPPAAFHQEQMVQPTPLPAPCQKVPCELPVEVISNLEEKHANPVNG 69  rabbit
NP_999613      2 MSQQYTLPVTLPPALSQEPLKPVSPPADTQQEQVKQATPLPAPCQKMLSELPVEVPLEDAEKHTTLVKG 70  pig
XP_010593295   1 MSQQHTLPVSLPAVLSQQPLKTVSPPLDTQQEQVKQPTPLPAPCQKVPSELPVEVPWEQGEKYTAPVKE 69  African savanna elephant
XP_015453793   1 MSQQTTLPVTLPPALRQQPLESASPPADTQQEQAKQPTLPPGPCQKVPPELPGEVPSVHREKHAAPGKG 69  black flying fox
P18174         1 MSQQHTLPVTLPPALSQGPLKPESPPIDTQQEQVKQPTSLPVLCQKMPSSLPGKVPLGHGEKHTSLVKG 69  dog
XP_011283459   1 MSQQHTLPVTLPPALCQEPLKPVCPPINTQPEQVKQPTPLPALCQKMPSKLPGEVHQEHGENHTTLVKG 69  domestic cat
NP_032438      1 MSHQHTLPVTVP-AVVQGPLKTVCSPDHIQQEQAKQPTPHPTQCQ-VFTEIQEKGFPKHEEKRPNPVKD 67  house mouse
XP_027241385   1 MSQQHTLPVTVP-SVVQESLKTVCPPAQLKLEQTKQPTSQPALCQKVFSETQEKGSTQQEEKGTTVegl 68  Chinese hamster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap