Conserved Protein Domain Family
TMEM189_B_dmain

?
pfam10520: TMEM189_B_dmain 
B domain of TMEM189, localization domain
TMEM189_B is the B domain or probable localization domain of the transmembrane protein TMEM189 which in some mammals is fused with Kua ubiquitin-conjugation E2 enzyme proteins. The domain is also found on fatty acid saturase FAD4 in Arabidopsis.
Statistics
?
PSSM-Id: 402241
View PSSM: pfam10520
Aligned: 49 rows
Threshold Bit Score: 193.235
Threshold Setting Gi: 218200588
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q38C19        92 MVLSDFISGVAHWSFDTWGTPETFLFGN-FIRSFREHHVNQMAMTKHDFIETNADT--------TLPLIPVLLIqlyflg 162 Trypanosoma brucei
Q89SH1        77 YFLADFFSGLVHWAVDTWLDEGG--LGRgIA-MTREHHTHPSHVLLYEFLDQASLGaapsavvvGISAAITALF------ 147 Bradyrhizobium ...
EFH45841     137 YILADLGSGVYHWAIDNYGDESTPVVGS-QIEAFQGHHKWPWTITRRQFAN-NLHAlaqvitftVLPLDLAF-------- 206 Arabidopsis lyr...
EFH64296     102 YVLADLGSGVYHWAIDNYGDKSTPLVGA-QLEASQGHHKWPWTITKRQFAN-NSHTiaraitftVLPLNLVI-------- 171 Arabidopsis lyr...
XP_009109154 115 YILADLGSGLYHWAIDNYGDESTPLVGT-QIEAARGHHKWPWIITIRQFAN-NSHAlargitftVLPLVLAC-------- 184 field mustard
O81006       105 YILADLGSGVYHWATDNYGDESTPLVGI-HIEDSQDHHKCPWTITKRQFAN-NLHFmargttliVLPLDLAF-------- 174 thale cress
1_pfamImport   1 YVLSDLASGIYHWGIDNYGSAKTLVFGN-QIDAFQHHHKQSWIITKSQFAK-NHRIlawgvtftVLPIDLLC-------- 70 
CBJ27287      40 YTIADLVSGVFHWSVDNYGDGSTPVFGA-VIEAFQGHHGSPWTITYRPFEN-NVHKia----yaVLPLLALL-------- 105 Ectocarpus sili...
EED94891       3 wVLADFGSGVFHWSVDNYGNGRTPVMGS-IIAAFQGHHSAPWTITYRGFCN-NVWKlcipfglpTVAAISYI-------- 72  Thalassiosira p...
EEC43146       1 wVIADFGSGVLHWATDNYGNGKTPVMGG-IIAAFQGHHSAPWTIAQRGFCN-NVYKlcipfgivPMLAINAI-------- 70  Phaeodactylum t...
Q38C19       163 cnsknnstfryNIDNDNAGFHVFFLTFALFIGMTNELHKWAHLP--APHPFARLLMSCRIVLTRKSHRRHHRGSYD-RSY 239 Trypanosoma brucei
Q89SH1       148 -----------PVSALTYALMIVWFVIATCMLFGMSFHNLAHWR--VRPPLLRMAQRLHLVCSPEHHLRHHRD-HT-VRY 212 Bradyrhizobium ...
EFH45841     207 ---------------NDPVFHGFVCTFAFCIMFSQQFHAWAHGtksKLPPLVVALQDMGLLVSRRQHAEHHRAPYN-NNY 270 Arabidopsis lyr...
EFH64296     172 ---------------NNPLFHSFVSIFAFCILLSQQFHAWAHGttsKLPPLVVALQDMGLLVSRKHHLGHHQAPYN-SNY 235 Arabidopsis lyr...
XP_009109154 185 ---------------NDPVVHGFVSMFAFCILFCQQCHAWAHErksKLPPLVVAFQDMGLLLSRRQHVNHHRHHRTyMSY 249 field mustard
O81006       175 ---------------DDHVVHGFVSMFAFCVLFCQLFHAWAHGtksKLPPLVVGLQDIGLLVSRIHHMNHHRAPYN-NNY 238 thale cress
1_pfamImport  71 ---------------KDPTILAFIGAFFGCIMFSQQFHSWAHGtknKLPKIVLALQDVGILVSRSQHAAHHQLPYN-NNY 134
CBJ27287     106 -----------RLVNPGPAGVALGVAFLVGSLMSNEFHRFAHMT--SPPPIVRALQKFGVTVSRKEHGRHHSSPFE-EKY 171 Ectocarpus sili...
EED94891      73 ------------AGPENSMVTLFFTFFCAIEIMSQELHKWSHMtkkETPAFVNTLQALGVTIARVPHAQHHLAPYD-GNY 139 Thalassiosira p...
EEC43146      71 ---------------APPDVVFFMATFCVFEIMSQEFHKWSHQlksETPGWVNWLQDSGLTIARKPHALHHLAPFE-GNY 134 Phaeodactylum t...
Q38C19       240 CITTGWLNAPLDRVDFWRKAEAVVTALTGAVPRAN 274 Trypanosoma brucei
Q89SH1       213 CVINGWANYPCDSLRLWSRLERLVTATTGRTPRAD 247 Bradyrhizobium japonicum
EFH45841     271 CIVSGAWNSVLDESKVFEALEMVFYFQLGVRPRSW 305 Arabidopsis lyrata subsp. lyrata
EFH64296     236 CVVSGAWNKVLDESKFFEALEMALYFQFGVRPRSW 270 Arabidopsis lyrata subsp. lyrata
XP_009109154 250 CIVSGVWNNVLDDNKIFEALEKVLYVQFGVKPRSW 284 field mustard
O81006       239 CVVSGVWNKVLDESNVFKAMEMVLYIQLGVRPRSW 273 thale cress
1_pfamImport 135 CLVSGLWNNFLDGYKVFELLERILFFIFGVRPRSW 169
CBJ27287     172 CIVTGVCNGPLDHFRVFRFMERVVYELNGVEPIAW 206 Ectocarpus siliculosus
EED94891     140 CIVSGLCNETLDKSGFFRWMEHKVYELNGVESNAw 174 Thalassiosira pseudonana CCMP1335
EEC43146     135 CIISGICNPVLDQSGFFRRLERVVYSLNGIESNaw 169 Phaeodactylum tricornutum CCAP 1055/1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap