Conserved Protein Domain Family
Bcl-2_BAD

?
pfam10514: Bcl-2_BAD 
Pro-apoptotic Bcl-2 protein, BAD
BAD is a Bcl-2 homology domain 3 (BH3)-only pro-apoptotic member of the Bcl-2 protein family that is regulated by phosphorylation in response to survival factors. Binding of BAD to mitochondria is thought to be exclusively mediated by its BH3 domain. Membrane localization of BAD mediates membrane translocation of Bcl-XL. The C-terminal part of BAD is sufficient for membrane binding. There are two segments with differing lipid-binding preferences, LBD1 and LBD2, that are responsible for this binding: (i) LBD1 located in the proximity of the BH3 domain (amino acids 122-131) and (ii) LBD2, the putative C-terminal alpha-helix-5. Phosphorylation-regulated 14-3-3 protein binding may expose the cholesterol-preferring LBD1 and bury the LBD2, thereby mediating translocation of BAD to raft-like micro-domains.
Statistics
?
PSSM-Id: 402236
View PSSM: pfam10514
Aligned: 7 rows
Threshold Bit Score: 163.633
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004019699   1 MFQIPEFEQSEQ-EDSSPADRGLGPSPTGD--RPpglskhwLTAPGLLGEAGHQQ-GQPAGSSHHGGTGAVETR------ 70  sheep
O35147        43 MFQIPEFEPSEQ-EDASTTDRGLGPSLTEDqpGP-------YLAPGLLGSIVQQQpGQAANNSHHGGAGTMETR------ 108 Norway rat
NP_001238857   1 MFQIPEFEPSEQ-EDSSSAERGLGPSPAGD--GPsgsgkhhRQAPGLLWDASHQQ-EQPTSSSHHGGAGAVEIR------ 70  chimpanzee
EHB04930       1 MFQIPEFEPSEQ-EDSSSEERALGPTPTGDrlGPss-------pgGFLGDISHQQ-RQLISSRHHGGTGATETR------ 65  naked mole-rat
XP_003419664   1 MFQIPEFEQSDR-EDSTPADRGLGPSPEGY--WPsgpsdrhRVAPGFLRDSSHQQ-GQPTSSGHHGGAAAVETR------ 70  African savanna...
XP_012408300   1 MFQISEFEPSEPgEDPSAST---APSLAPLrpGP-------RAAPG---------------AHHHEGAGAGRPRlisyp- 54  Tasmanian devil
1_pfamImport   1 MFQISEFEPSEPgEDPSAST---APSLAPLrpGP-------RAAPG---------------AHHHEKGGAQKSQthvske 55 
XP_004019699  71 --------------------SRHSSYPAGPEDDEGTEEEDlGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-KGL 129 sheep
O35147       109 --------------------SRHSSYPAGTEEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-KGL 166 Norway rat
NP_001238857  71 --------------------SRHSSYPAGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFkKGL 129 chimpanzee
EHB04930      66 --------------------SRHSSYPTGMEEEAGMKEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-KGL 123 naked mole-rat
XP_003419664  71 --------------------SRHSSYPAGSDEAEGLEEDP-SPFRGRSLSAPPNLWAAQRYGRELRRMSDEFQGYF-KGL 128 African savanna...
XP_012408300  55 ---------------plregSREASPEAEAEAEQSEGEEErGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTF-KGL 118 Tasmanian devil
1_pfamImport  56 lkasasqgrlgkgsfegregSREASPEAEAEAEQSEGEEErGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTF-KGL 134
XP_004019699 130 PRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ 168 sheep
O35147       167 PRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ 205 Norway rat
NP_001238857 130 PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ 168 chimpanzee
EHB04930     124 PRPKSAGTATKLWQSSSWTRAIQSWWDRNLGRGGSAPSQ 162 naked mole-rat
XP_003419664 129 PRPKSAGTATQMRQSPSWTRIIQAWWDRNLGRGSSAPSQ 167 African savanna elephant
XP_012408300 119 PRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSh 157 Tasmanian devil
1_pfamImport 135 PRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPS- 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap