Conserved Protein Domain Family
PIG-S

?
pfam10510: PIG-S 
Phosphatidylinositol-glycan biosynthesis class S protein
PIG-S is one of several key, core, components of the glycosylphosphatidylinositol (GPI) trans-amidase complex that mediates GPI anchoring in the endoplasmic reticulum. Anchoring occurs when a protein's C-terminal GPI attachment signal peptide is replaced with a pre-assembled GPI. Mammalian GPITransamidase consists of at least five components: Gaa1, Gpi8, PIG-S, PIG-T, and PIG-U, all five of which are required for function. It is possible that Gaa1, Gpi8, PIG-S, and PIG-T form a tightly associated core that is only weakly associated with PIG-U. The exact function of PIG-S is unclear.
Statistics
?
PSSM-Id: 402233
View PSSM: pfam10510
Aligned: 100 rows
Threshold Bit Score: 260.66
Threshold Setting Gi: 307769097
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
GAC96405      18 TCFWVALLASIPSWLRLTTIQRLPLPTKQVEALHYpDDCPVAFQssLTVS-VDPTIISEdggqeegekDAQASFLKQVEQ 96  Pseudozyma hube...
XP_001507200  22 SFATVAIVVGLPLWWKTTETYRASLPYSQISQLGD-LRLQLTVP--ISVV-FAKGALPI---------EAQRKLP-YTDT 87  platypus
XP_003996538  22 FFAAVAIVLGLPLWWKTTETYRAPLPYSEISGLNA-LQLRLMVP--VTVV-FTRESVPS---------DDQEKLP-FTVV 87  domestic cat
XP_003770093  46 CFATMAVMLGLPLWWKTTETYRAALPYSQIGHLDS-MLLRLRVP--VSVV-FIQGSLPI---------VDQQKLP-FTVV 111 Tasmanian devil
XP_005056851  23 SFATIAVVLGLPLWWKTTETYRAALPYADIDGLGQ-QPVRLVVP--MAVV-FGPGSVPR---------DLSRSLP-FTDV 88  Collared flycat...
XP_003227327  25 SFAAIAVVLGLPLWWKTTETYRASLPYAEIAELDT-LRFQLTVP--VSVV-FAKGSLPA---------KQERKLP-SRKM 90  green anole
XP_006005796  22 SIAAIAILLGIPLWWKTTETYRASLPYSQIRELDT-LWFQLMVP--VEVI-FAKGTLRA---------EQQRQIP-FSQS 87  coelacanth
XP_002113280  17 AVGVVIIVLGVPLWWVTTEVYRAPLPYNRIAQLAF-LQPQSVVP--VEVVwLTKGEGVT---------EESTKLSELLKA 84  Trichoplax adha...
XP_012811796  22 SIALITAVLGLPLWWKTTETYRASLPYSDIRGLET-LQLHLTVP--IEII-FGKATLTA---------EQQRNVP-STGL 87  tropical clawed...
XP_003971341  17 SIAAVVIIVGVPLWWRTTETYRAWLPVSQINALSN-LQLQLSAD--VEVV-FARGTVTP---------EQQKKVP-VTQT 82  torafugu
GAC96405      97 LVQQSLeikAglpaaASLectrWKVDVHATsSAGsLp-----------------pLdLETGAYAVRVASET-----SSDD 154 Pseudozyma hube...
XP_001507200  88 QERKIPlnyK-----MTInc-lFEKSYRNTiDQE-EvalglanvqeadavlslvqE-SPEGMLTVYVVPEAssllpQDVM 159 platypus
XP_003996538  88 HEREIPlkyK-----MKIkc-rFQKAYRRAlDHE-EealslgsmqeaetmlaepqE-QAEGSLTVYVIPEHssllpQDMM 159 domestic cat
XP_003770093 112 NERDVPlkcK-----MKLkc-rFQLAYRMAgSHE-EkafkkdtieeaeaalplpkE-DTLGSLNIFVIPEKssllpKDKM 183 Tasmanian devil
XP_005056851  89 QEMEISvnlR-----TTVts-rYEMRYRSTtAQE-EaalfaatareadaalhplqD-TTMGSLTMYVVPETssllpQGIN 160 Collared flycat...
XP_003227327  91 QDVEIPlnpK-----TSVts-hYEMFYRRAtTQE-EmilaqksleevdsslrtteE-TSMGSITVYVVPQNslllpQDVA 162 green anole
XP_006005796  88 RQKEAQlnsK-----TGFry-rYETKFRAAtAME-EtalalpgvqeaeetlsrlkE-TPEGTVLVYIIPETslllpQGIK 159 coelacanth
XP_002113280  85 NLKSASsdnM-----TIIdy-iITTRVGNEmEME-IvkenlialneldrklgalnP-ESQG-FRFYLLRPSqikspIN-R 154 Trichoplax adha...
XP_012811796  88 KETETVlnaQ-----TSItr-hYEFKYRRTsVDE-EealglkslqdannalqklgE-TAHGSITIFILPESsvllpKGIR 159 tropical clawed...
XP_003971341  83 WDEKHAvneD-----TSLny-rYEVKYRTAtVME-EdalnqptaaaadlslhtlsE-SWCGSLGVYVIPESssllpEDVD 154 torafugu
GAC96405     155 ADAHQSGVPTVYLpnptdepaslplVPDTVSAAVIAELLHLRGDKppsTAADDtsasTISDTQ--------HdPRVIQYS 226 Pseudozyma hube...
XP_001507200 160 GYVGKRRGAVVRgar-------gqqALALVEQRVQQVIQATSVTD---DVLAAaladRLSGDKws----sdR-RRPLKSS 224 platypus
XP_003996538 160 SYIGPERTAVVRgim-------hreAFNIVGRRVIQVAQAMSLTE---DVLAAaladHLPEDKws----sdK-RRPLKSS 224 domestic cat
XP_003770093 184 SYIGPKRTAFVRgtq-------vrqGPTGMGQRILQVAQSMSLTD---EVLAAalgdRLPEDKvs----ldK-RRPLKSS 248 Tasmanian devil
XP_005056851 161 VYVGKHRSALVRav----------gSLAALQARLREVTQVMSFTA---SSIAAalsdRLPSRQlg----pdA-RRNLKSS 222 Collared flycat...
XP_003227327 163 VFVGKHRSAVLRspln------aedALTKVDAHVQRVAHAMSFTP---DSLAEaladRVLIGQpg----aeW-KRPVKSS 228 green anole
XP_006005796 160 TYIGKRRTAVLRavlsqs--hrmedTLDEISPQVQRVVQTMSFTD---DVIASavsdRIPIGKfnketyadN-MKALKSS 233 coelacanth
XP_002113280 155 IYVGSYYSTFIVlndge----ryesFATKIQLVVKDIYVNEKVLR---NTVTSilgfRekka------dveS-MRAIRST 220 Trichoplax adha...
XP_012811796 160 VYIGKHRIALVRcalsts--lgsedIANTVYKKVEHVIQTMSFTD---EAVTAalsdRIPIGKfskedfenS-RRAFKSS 233 tropical clawed...
XP_003971341 155 VYIGQRRTALLRIgsqvkvgrtleqLLTHLKPRLKQVLQVMSFSR---TDITAalsdRVRVSPgnqesiadS-MRAFKSS 230 torafugu
GAC96405     227 KHVRLVFSIMNQDVTDg-sAYDSQlvhDLASAnastsnPITRLTSELSGLHDFHVETQVQWFAPLQFQPTReilEEVvei 305 Pseudozyma hube...
XP_001507200 225 LGYEITFSLLNPDPRShdvRWAIE---GAVRH------YVQPFLDKLRPAANFSVDSQILYYAMLGVTPRY---DTAs-- 290 platypus
XP_003996538 225 LGYEITFSLLNPDPKShdvHWDIE---GAVRR------YVQPFLSALSAAGNFSVDSQILYYAVLGVNPRF---DPAs-- 290 domestic cat
XP_003770093 249 LGYEITFSLLNPDPKShevHWDIE---GAVEN------YVQPFLSLLSVVGNFSMDSQILYYAMLGVTPRF---DAAs-- 314 Tasmanian devil
XP_005056851 223 LGYEITFSLLNPDPKShtvDWDIE---GAVNR------YVKPVLDKLSLVANFSVDSQILYYAVLGVTPRY---DKEs-- 288 Collared flycat...
XP_003227327 229 LGYEITFSLLNPDPRShdvHWDIE---GAIRR------FVKPMLEKLSPVAEFSVDSQILYYAALGVTPRF---DPAs-- 294 green anole
XP_006005796 234 LGYEITFSLLNPDPKShdlHWDIE---NAVNY------YIQPFLGKLSSMANFSMDSQILYYAILGVTPRH---DKAs-- 299 coelacanth
XP_002113280 221 DSYQLSFTLINPEPHNliaKWKIA---DAIRI------YLDPFLKALKDFSSFTIDSQVLYYSGLSIRPSQ---DSAt-- 286 Trichoplax adha...
XP_012811796 234 AGYEITFSLLNPDPKShdlNWNIS---SASDQ------YIQPFLDKLQNVANFSMDSQTLYYAMLGVTPRF---EKSt-- 299 tropical clawed...
XP_003971341 231 PGYEITFSLLNPDPKShrlHWDIE---GGVET------YIQPLLTKLAPLANFSIDSQILYYAMLGVNPRF---DSSs-- 296 torafugu
GAC96405     306 dveeevmvdqeveevVeVEvdnedpaegevasastieadaeaseverelpsapstgrrkktikqtqkrtiqvpriqhtrk 385 Pseudozyma hube...
XP_001507200 291 --------------aS-YV------------------------------------------------------------- 294 platypus
XP_003996538 291 --------------sS-YY------------------------------------------------------------- 294 domestic cat
XP_003770093 315 --------------sS-YT------------------------------------------------------------- 318 Tasmanian devil
XP_005056851 289 --------------sS-FL------------------------------------------------------------- 292 Collared flycat...
XP_003227327 295 --------------sS-YR------------------------------------------------------------- 298 green anole
XP_006005796 300 --------------sS-YI------------------------------------------------------------- 303 coelacanth
XP_002113280 287 --------------gS-YY------------------------------------------------------------- 290 Trichoplax adha...
XP_012811796 300 --------------sS-YI------------------------------------------------------------- 303 tropical clawed...
XP_003971341 297 --------------sA-YT------------------------------------------------------------- 300 torafugu
GAC96405     386 qkrtplpprnVvEWDDLKVFVNSQEWSLTSTVppsSSSSQrnhtvdgrpydilsqthdLHFLLYIPSKSNTPLFIRDIVk 465 Pseudozyma hube...
XP_001507200 295 ----------L-PVHSLPHVINPVEARLGSSAa--SLYPV------------------LNFLLYVPDRSHSPLYIQDKDg 343 platypus
XP_003996538 295 ----------L-AAHSLPHVINPVESRLGSSAa--SLYPV------------------LNFLLYVPELAHSPLYIQDKDg 343 domestic cat
XP_003770093 319 ----------L-AAYSLPHVINPVEARLGSRAt--SLYPV------------------INFLLYVPERAHSPLYIQDKDg 367 Tasmanian devil
XP_005056851 293 ----------L-SAHSLPHVINPVEARLGSSAa--SLYPV------------------LNFLLYVPERSHSPLYIQDKDg 341 Collared flycat...
XP_003227327 299 ----------L-SVHSLPHVINPVEARLGSSAa--SLYPV------------------LNFLLYIPEDLHSPLYIQGKDg 347 green anole
XP_006005796 304 ----------L-SAESLPHVINPVEARFGSSAa--SLYPV------------------LNFLLYVPDYAHSPLHIRDHHg 352 coelacanth
XP_002113280 291 ----------L-TPRLLPRVINSIESRLGSHAt--N-NPA------------------ANFILYVPETKFKNLHIRTSKn 338 Trichoplax adha...
XP_012811796 304 ----------L-NLHNLPHVINPVEARLGSSAa--SLYPV------------------LNFLLYVPEYSHSPLYIQDKDg 352 tropical clawed...
XP_003971341 301 ----------L-NADSLAHVINPVEARLGSNAa--SSNPV------------------LNFLLYVPDAQHSPLHIHNYNk 349 torafugu
GAC96405     466 GGveeagGWLIPQWGGVVILNAEDDpaeEnglishhqgaggggggkVIELSEAkVVGAMTLFSRQLEILLGLSdi----- 540 Pseudozyma hube...
XP_001507200 344 APva-tnAFHSPRWGGIMIYNVDLS---Asna-----------telPVRVEVD-MVRVMEVFLAQLRLLFGISqaqvpad 407 platypus
XP_003996538 344 APva-tnAFHSPRWGGIMVYNVDPK---Ayna-----------sklPVRVEVD-MEQVMEVFLAQLRLLFGIAqpqlpvk 407 domestic cat
XP_003770093 368 ARva-tnAFHSPRWGGIMVYNVDPS---Aynt-----------tkyPVKVDVD-MVPVMEVFLSQMRLLFGIPppqmpen 431 Tasmanian devil
XP_005056851 342 APvs-tnAFHSPRWGGIMVYNVEVP---Aspq-----------aslPLHVDVD-MARVMEVFLAQLRLLFGLSreevppe 405 Collared flycat...
XP_003227327 348 SAvp-tnAFHSPRWGGIMIYNVGPD---Tane-----------tsfPKRVDVN-MVAVMEVFLAQLRLLFGVSqtplpeg 411 green anole
XP_006005796 353 AQvt-tnAFHSPRWGGIMVYNVKHK---Nsne-----------tlfPIRVDID-MVRVMEVFLTQLRLLLGIQkvetpad 416 coelacanth
XP_002113280 339 DSrm-tySFISPRWGGFII---DSK---Ahna-----------lntSKVYEVD-LKEAMDIFVAHLKLLLGIPkismsgd 399 Trichoplax adha...
XP_012811796 353 SRip-tnAFHSPRWGGIMIYNVDYG---Nlge-----------lqfPVHIDID-MVRVMEVFLTQLRLLLGITkaavped 416 tropical clawed...
XP_003971341 350 QEvp-tnAFHSPRWGGIMIYNVDDL---Ygpe-----------vtfPVDIDIS-MARVMGVFLAQLRLLLGVQsstpppg 413 torafugu
GAC96405     541 pTSPlqr------niRLSTLQQRRTLELARETTSTLTAITRLVDRIENLGVGPPVKSDVQSSLDIIQSLAAAQnETQSLS 614 Pseudozyma hube...
XP_001507200 408 fQLEnpgne-glaawELDRLLWARTVENIATVATTLTSLAQLLDKIGNIVIKDDVASEVYQAVEAAQSAAAEL-EAGRLG 485 platypus
XP_003996538 408 cLFSgpkse-glttwELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYRAVAAVQKAAEEL-ASGHLA 485 domestic cat
XP_003770093 432 fLLGdppre-glrswEVDRLVWARTVENVATVVTTLTSLAELLDKIGNIVIKDNVASEVYRAVDAIQEAVVEL-SAGNLE 509 Tasmanian devil
XP_005056851 406 fLLEspgne-gladwELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYQAVASVQSAVTKL-SLGHLQ 483 Collared flycat...
XP_003227327 412 aLLAnpgna-glcdwELDRLLWARTVENVATVSTTLTSLAQLLGKIGNIVIKDDVASEVFHAVESAQGALQEL-EAGQLE 489 green anole
XP_006005796 417 vLLQspgne-gitdwELDRLLWVRTVENIATATTTLTSLAQLLDQIGNIVINDHIASEVYSSVASVHATLSEL-EAGRLS 494 coelacanth
XP_002113280 400 kRLEfgksdvglskwEYSCLLRRRTLENVASANQTLTSLAKLLEEITNIVISDRIKELINLSIEELHKSLDFM-KSGDNA 478 Trichoplax adha...
XP_012811796 417 yQLEspgne-gltdwELDSLLWSRVVENIATVTTTLTSLAQLLDQIGNIVINDIVASEVYHAVSSVQTALSEL-EAGRLE 494 tropical clawed...
XP_003971341 414 fMVApcssa-gladwELDRLMWSRSVENIATATTTITSLAQLLDQIGNIVINDNIAEQVSSAVTSLQLAVAEL-EAGNL- 490 torafugu
GAC96405     615 E-LFERTREAHALSNRAFFNPDMLGLLYFPDEHKYAVYTPLFAPLLVPLIVTTVKLLKELAET 676 Pseudozyma hubeiensis SY62
XP_001507200 486 P-AFQASRTAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKILREARQA 547 platypus
XP_003996538 486 S-AFTASQEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKIFLETRKS 547 domestic cat
XP_003770093 510 L-AFRYSREAVTSSEKAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPIFLSMIKIIVENQKA 571 Tasmanian devil
XP_005056851 484 A-AFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLAKIVRETRLR 545 Collared flycatcher
XP_003227327 490 A-AFLASKAAVTSSERAFFHPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSMAKILRESRAA 551 green anole
XP_006005796 495 S-AFHASKQAITSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPIILSLLRIASDFRQA 556 coelacanth
XP_002113280 479 R-AFAHSKTAVTNSEKAFFDASLLELLYFPSDQKFAVYVPLFLPISLPILQSLYHAIRFLYRQ 540 Trichoplax adhaerens
XP_012811796 495 S-AFQASKEAISSSEKAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPIFLSLIKIAKEYKQS 556 tropical clawed frog
XP_003971341 491 GfALQYSKEAFSASERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMCVPILLSLLKILTELRQR 553 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap