Conserved Protein Domain Family
IFT57

?
pfam10498: IFT57 
Intra-flagellar transport protein 57
Eukaryotic cilia and flagella are specialized organelles found at the periphery of cells of diverse organisms. Intra-flagellar transport (IFT) is required for the assembly and maintenance of eukaryotic cilia and flagella, and consists of the bidirectional movement of large protein particles between the base and the distal tip of the organelle. IFT particles contain multiple copies of two distinct protein complexes, A and B, which contain at least 6 and 11 protein subunits. IFT57 is part of complex B but is not, however, required for the core subunits to stay associated. This protein is known as Huntington-interacting protein-1 in humans.
Statistics
?
PSSM-Id: 402224
View PSSM: pfam10498
Aligned: 46 rows
Threshold Bit Score: 265.272
Threshold Setting Gi: 557734242
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001020901 294 EDIYEKLTLLEYH--NFFCKPMH--RDPVSKVFFSisdqTPAQNNKKFFYFAELCYWIMSIQKyDKknkIQA---AL-KL 365 Tetrahymena the...
EFC50338      50 EKIIDKLKLLNYErrKDLFPSHA--YGGLPRYYFAh--hDKDHPHEQFHTFIAVTTWLISDVLkLDd--YER---PDfQL 120 Naegleria gruberi
A0C6M8        18 DELYDKLILLNYE--QSYLKQKG--GKPLNRAYFV----NQTNSSEQFNQFKTLVKWLFQQNDvQT---SDF----N-KL 81  Paramecium tetr...
XP_001313886  16 RQIYDNLQYLNYE--TDFDPIKRk-LPYLTPIYFAv---QQKSPKEQFDYFAGLCVWMMQTFNgSQ---IET---PS-DY 82  Trichomonas vag...
ESS30354      37 eRIYNLVSLVNSCd-EKLLDCRD--LKRLTRYSFCl---hEEPAWPQLQLYQSWVVHILRLLG---------------KE 95  Toxoplasma gond...
Q4DZS7        28 EDLIDKLRILRYE--KDFCPRVKppFKPLSKYYFSgp-sSIDNPNAQFHYFTSLCSWLMGLAG-HN---FEP---PG-QF 96  Trypanosoma cruzi
XP_001709844  15 QSLVAKLRQLNCE--KNYCHPNN--LPGFTASAFYk---ESSSPLDQLVQTARLCHWLLSQLG-IS---VQG---VS-EF 79  Giardia lamblia...
A0E8V3       292 EDIYEKLSLVQYH--QNFCVPLK--KKPISKYFFSld--eSVNSSYRFYYFVDLCYWLMNLPKqKKnklAQPikyS---- 361 Paramecium tetr...
EGR31851     294 EDIYEKLTLLEYQ--KYFCKPIN--RKPISKIYFAlpdnNMILNNEKFFYFAELSYWIMSIKKyDQknkILA---AQ-QL 365 Ichthyophthiriu...
KAE8889629    26 GNVLEKLRVLQYE--REFGKKKS--FAPFSETQFAvl-aaGTNASAQFKGFLDLVTFLLKSCG-QE---FVV----D-KY 91  Phytophthora fr...
XP_001020901 366 kslgnwESVDECAQQLLFDLKKWGLRLpDsLNVQHIRNGYGDTVCFILNDILNRELIRLNFKFEDPKHTDVQNg------ 439 Tetrahymena the...
EFC50338     121 ------DDPNTTTQNLAFYLKKMGIPM-D-FPPTKLRQAWGEPVCYVIDQLLNRALKESKVKLKAPEIPEEIK------- 185 Naegleria gruberi
A0C6M8        82 ------DDPVTLSQNIINELKNIGIEV-D-FPPIKLKQGFGEYVVYVLLQLATKALQKKKFQYKKAKIEQQSQt------ 147 Paramecium tetr...
XP_001313886  83 ------DQPATVTDNIFNNLNGLGIKV-S-FQPAKLISGHGSHCCLILDALCRMSLKKKGFS------------------ 136 Trichomonas vag...
ESS30354      96 ieirkdDDPVAVTEAIVDSLQGFHFGGiE-VSVSSLRKGWGYIPCKVLHELLKELVTGR--ALQLPTYDPCNRkcgaths 172 Toxoplasma gond...
Q4DZS7        97 ------DDPNATSTNILGELRAMNISApN-LAPNRIRQGSGEAVLTILSVLSDHALLKKGFTVRSVDYTNVEK------- 162 Trypanosoma cruzi
XP_001709844  80 ------DDPIAISTDLLVACKDI-VNVaN-IPPHRIRMGYGDDLTALVLGIADACLAKL-----QPNIVSWKSl------ 140 Giardia lamblia...
A0E8V3       362 ------NNLEDTARKLLQDIKAWGIKLpEqLGSPHISSGFGDMVCFILNDLLNRELIRVNFKFELPQFGGDLSnsqvpsh 435 Paramecium tetr...
EGR31851     366 kdngiwDSIEECGQQLLQDLRKWGSRLpDqLNISHIRNGYGDTICFILNDILNRELIRVNFKFDQPIFKNEQCdqk---- 441 Ichthyophthiriu...
KAE8889629    92 ------DDPNTSVNKLILTLKTLGFPL-D-FPASKLKLGYGEAVCAALDFICDQALAARRFDWPRPQYP-KED------- 155 Phytophthora fr...
XP_001020901 440 ---QQETENGvLQDpdlneymieeEDIQDEDSIVGE----------------EEQGDLlngqynKRQNGEEaydykKIID 500 Tetrahymena the...
EFC50338     186 ---FRDDDEIpEES----------EDIEDNEDMQHDnd-------------sENEDEM------YYTVGSKndtgsKDQE 233 Naegleria gruberi
A0C6M8       148 ---rQDDEPVqETGsvssdsdpdvASEEEPEDVFTEqg-------------fQKDEDK---------------------- 189 Paramecium tetr...
XP_001313886 137 ---PSSFRVVsGLGgkddevevrgEDDEDDIVDDVVdv-------------qEDEDKEnda---------------iitD 185 Trichomonas vag...
ESS30354     173 v----------------esiedfaESHEADLGAHSGff-------------sSDSEDG---------------------- 201 Toxoplasma gond...
Q4DZS7       163 ---YDELDGVtDADddn----gigEEVEDNVMI-------------------ESDDEEel--yvRATGERL------VKE 208 Trypanosoma cruzi
XP_001709844 141 --gSENANAGvERDnddddapildDLIVDDALIGTMtakkgtfttaaglatgSLTTDS---------------------- 196 Giardia lamblia...
A0E8V3       436 hiqYDEQDFPeELTeedqd-evenDEFTQSILFYQKkf-------------kTEQPDF------------------NQIP 483 Paramecium tetr...
EGR31851     442 ---------------------vilLDSENEESIKEInsin--------------------ssyyEEEKHEEfinkdIEKN 480 Ichthyophthiriu...
KAE8889629   156 ---FADEAEV--DDdae----vdtANDNDENALPGAeeeaeelysdlvrsgkAAEDQH------------------DLDQ 208 Phytophthora fr...
XP_001020901 501 EDREMIISNVDPLEWQKECLR--------VTTELQNfdlkiKKnEitAQINenDYINNLNRLQKFQRgmNMQAQILQ-EP 571 Tetrahymena the...
EFC50338     234 KHLEMIEGYHNAQEWRLETER--------LSSQLVV-----RL-N--VDHK--DWRTHVESMEEQNV--SIRDLTPSsTS 293 Naegleria gruberi
A0C6M8       190 ---MVIESNVNPKEWAKEVER--------AAQKIKI-----VI-K--PDAG--EWRQHFDATKQYSN--SIKTILPEaRI 246 Paramecium tetr...
XP_001313886 186 YGNDPQSKVIDSLELKAEAER--------VAPRLQI-----RI-P--AEKS--DWRTHFSQMNTHQK--TITDIMTQlSP 245 Trichomonas vag...
ESS30354     202 ---------------EIEARRaedlnepeAAPAASAlnkmsRTfA--QD----QWKGEVEQTLEFKK--TFDEQLPSlCH 258 Toxoplasma gond...
Q4DZS7       209 DAGVPLESEINAEEWNLEVER--------VGPLLQV--------R--SDALq-DWRSRIESAGVLLR--AVEKMYPEvKQ 267 Trypanosoma cruzi
XP_001709844 197 --GCIAPGLISEADWEQELMA--------VDSQLGGkqlggVY-----AGQ--DWRKDVVSMSLLAK--ALSKETGScAQ 257 Giardia lamblia...
A0E8V3       484 QNRQIIQTKIALNEWTNEYNR--------VEKELNKfeinlKEnK--SYLN--DYQRSMNLVKKCSKqlTIASQYFK-SN 550 Paramecium tetr...
EGR31851     481 ENNIIIKSEINEQDWKKEYKR--------VYQELHDfdkniNKfE---RQKqeEYYFNLYKMQKYKK--SLKNDIFEyKS 547 Ichthyophthiriu...
KAE8889629   209 SFQQMIMSEVDPLLWKTELER--------VGPRLKLkg--gAGaA--AAGK--EWHAHIERSREHET--VMRELLPRaNA 272 Phytophthora fr...
XP_001020901 572 FVNKIITNWQNQLDQIEKGEQRI--NQGNIDSINV-LKEKVQSKKKFLLDLEQKSEQVKSQIQNFDSMNEQYEKVKKEIV 648 Tetrahymena the...
EFC50338     294 QLEKIAEDIEKINSRIQKREKMLsdDSSIGNLLAN-YSKNQQELDEITKKYKELEETISVLSGDLGKINQDLSDIKVNAE 372 Naegleria gruberi
A0C6M8       247 KLERISDELGEILDRITKREYNI--NENMSEMCLE-FKKKNEEYKKIELQYQNYTNAKKEMTDQYKQIQEKFETVQNKLN 323 Paramecium tetr...
XP_001313886 246 ILTKVGADVTQAIDAIENREKML--NNRFQTSVVD-YAERAKQLETVEKKYHERVTTVNNLKTALNDVIDKLNNTKQNLD 322 Trichomonas vag...
ESS30354     259 AFKQLHEELQEMLTKVETREKWI--EQKFSHIISD-HGEVHQELVNQTKRRQKLVVQLEDLQTKQAVTQEACDRSSKLLQ 335 Toxoplasma gond...
Q4DZS7       268 MLQHVADDLEKSRDRIQKREQTL--AQQFSDQVED-YRVKLRELNTSQDSANMASQSVEQLSAELNQLSGLLDQVKRGIE 344 Trypanosoma cruzi
XP_001709844 258 SISGLVTDFGKQLERISTREQHL--NSQVGQYSAK-LGDANRTHAGVTEELAELSQSISALTGELSTINEKLRALKVELQ 334 Giardia lamblia...
A0E8V3       551 EVQDIQQQWINYLEIIPKLETQI--TNLIQPELREiLYNNRQTISQFEIKINTLSKSNSSKLE----LDQQLHQNIVDIQ 624 Paramecium tetr...
EGR31851     548 IHDKFYVQLQNQLDDIKNGQYII--NSGNLENIQI-LQEQARNKNEFLKELKQRSEQVELYVKHLNNLKEQNTRIKKQIQ 624 Ichthyophthiriu...
KAE8889629   273 QLRLLGTQLTEAAGRMGAKEKTL--NNQYEHLRQE-YTALKEKLQAATEVSKAGADRVNVMTTEYAETTEQLKETKGVMD 349 Phytophthora fr...
XP_001020901 649 EREKLITGNDQTNKIKDAIQKIKTEIKSMTIKIGVLQSNL 688 Tetrahymena thermophila SB210
EFC50338     373 DLTKKMADTTPLREIKEALVKIRNDIKQMDMRAGVLQNQV 412 Naegleria gruberi
A0C6M8       324 EHGSVSTNQSPVISIKASLTKLRLEIKQMDLRIGVLSHTI 363 Paramecium tetraurelia
XP_001313886 323 EKQKEVSDNSPLMNIKTALAKLKEDIKQLELRSAILQRSL 362 Trichomonas vaginalis G3
ESS30354     336 DKCNRATDARPIQELTKTLTTLRKEIKQMELRSGVLQHTs 375 Toxoplasma gondii VEG
Q4DZS7       345 DREAKISDTTPLMQVKDAVTKVRAEIKQMSLRIGVLQHAV 384 Trypanosoma cruzi
XP_001709844 335 VESARASDTSNIHIVKTAFSSLSGEIRQLDLRITLAQQRL 374 Giardia lamblia ATCC 50803
A0E8V3       625 SRIPTLNDNRP--KQRQIINQLKSDINDLNVKIGILQTQL 662 Paramecium tetraurelia
EGR31851     625 EKEKLITNNNQKQKIQEAIINLNKEIKNMNLKIGIIQASI 664 Ichthyophthirius multifiliis
KAE8889629   350 ERGAKMTDTSPLVHIKDALKTLAAEIKNFELRIGVVSHTL 389 Phytophthora fragariae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap