Conserved Protein Domain Family
PI3K_1B_p101

?
pfam10486: PI3K_1B_p101 
Phosphoinositide 3-kinase gamma adapter protein p101 subunit
Class I PI3Ks are dual-specific lipid and protein kinases involved in numerous intracellular signaling pathways. Class IB PI3K, p110gamma, is mainly activated by seven-transmembrane G-protein-coupled receptors (GPCRs), through its regulatory subunit p101 and G-protein beta-gamma subunits.
Statistics
?
PSSM-Id: 402214
View PSSM: pfam10486
Aligned: 15 rows
Threshold Bit Score: 1266.54
Threshold Setting Gi: 1174697862
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011472108   4 TSCTEDRIQHALDRCLDGLRQSPT-AAHHWNvlmcsAGQSMNRWSLEELVKRDPENFLILLQQILRKAKEVQEQCQYELV 82  Japanese medaka
XP_022530922  20 TSCTEDRIQHALDRCLDGLQASST-LSQSWN-----TGWCMNRWSLEELLRRDPENFLILLQQILTKARQAQEENEYELV 93  Mexican tetra
XP_009300642   4 TSCTEDRIQHALDRCLDGLRPSEN-LSQSWS-----AGWCMNRWSLEELIKRDPDNFLILLQQILRKAREVQQECHYELV 77  zebrafish
2_pfamImport   1 SSCTEDRIQHVLERCLSGLGLDTP-NKQLWN-----AGLCINRWCLEELVKRDAHNFLILLQKILRKTTEVIQQCRYELV 74 
XP_019213753   7 SSCTEDRIQHVLERCLSHLGVDTP-DTQLWK-----AGLCINRWSLEELVKRDPHNFLILLQQILRKTKEVLEQCQYELV 80  Nile tilapia
XP_015212007   4 TSCTEDRIHHALERCLHRLSQSSS--ADTWS-----AGLCMNRWSLEELVNRDPENFLILLQQILKKTREVQEQCEYILV 76  spotted gar
XP_005256637   6 TTCTEDRIQHALERCLHGLSLSRR--STSWS-----AGLCLNCWSLQELVSRDPGHFLILLEQILQKTREVQEKGTYDLL 78  human
XP_001366777   6 TTCTEDRIQHALERCLHGLSVSRG--TTTWT-----AGLCLNCWSLQELVSRDPDNFLILLEQILQKTTEVQEKCSYDLL 78  gray short-tail...
Q5ZIB8         4 TTCTEDRIYHALERCLHGLSRDAV--SSRWA-----AGLCLNCWSLQELVSRDAGNYLILVEKILGKAREVQEKCDYDLV 76  chicken
XP_003217124   4 TTCTEDRIHHALERCLHGLSKSGTiSASTWT-----AGLCLNCWSLQELVSRDAGNYLILLEKILQKTQEVHDKCDYDLF 78  green anole
XP_011472108  83 APLAIMFLSTLLQTPYLPPDTDLLEEAIKVFYIFLTWPEPYCSVCRDLLSTLQLEMKSPGISFQRLVREEQGLRTSSHSS 162 Japanese medaka
XP_022530922  94 APLAIMFESTLIQTPHCPLDSDLLAEACEVFHGFLTWPEPYSNVCCSLLSTIQQELRAPGISYHRLVREEQGLAAAVQSR 173 Mexican tetra
XP_009300642  78 APLALMFESTLLQMPLCPSSEKVLTEACEVFHGFLAWPEPYCSVCRNLLSTLHQELRAPGISYHRLVREEQGLATSSQRS 157 zebrafish
2_pfamImport  75 VPLTLLFSSTLLKAPHVAPDCGLLEEAYLLFHRFLAWPEPCSSASKTLLKIIQKERRAPGISFHQLVRTEQGICPEIQFS 154
XP_019213753  81 VPLSLLFSSTLLRAPYLPADCGVLQDANLLFHGFLSWPEPCSSAAKRLLNVIQQELRAPGISFQRLVRTEQGISHEIHCS 160 Nile tilapia
XP_015212007  77 APLALMFFSTALQTPYFPPHCDLLREACEVYHSFLTWPEPYCSVCRDLLTFIHQELKAPGISYHRLVREEQGLATDNQQS 156 spotted gar
XP_005256637  79 TPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRS 158 human
XP_001366777  79 APLALLFYSTVLCTPHFPPDSDLLLKAARTYHRFLTWPIPYCSICQELLTFIDAELKVPGINYQRLVRAEQGLSIRSHRN 158 gray short-tail...
Q5ZIB8        77 MPLALLFYYAVLYAPHIPPDSELLLKAASIYHSFLTWPVPYCDVFRELLTFISDELKAPGISFQRLVRTEQGLPVKNYQS 156 chicken
XP_003217124  79 APLALLFGAAVLSIPHFPSDSDLLPRALRIYRDFLTWPVPYCDICQELLTFINNELKAPGISFQRLVRAEQGLPAKTHET 158 green anole
XP_011472108 163 KTITVLLMNPDE-VPHEFLSVAEQLSHVQHSQRETYTTLIKHAFQSALGTKYSLHSIHRALQAKTESELANTYSLMSGIL 241 Japanese medaka
XP_022530922 174 RTITVMLLNPAD-VPASFLSVLEQMSGAEVSRRDSSITLIKHAFQSTLGTKYPLPSIHTALQSLGEEEMEQAVLLVTELL 252 Mexican tetra
XP_009300642 158 KIITVFLMNPTE-VPPEFLSVAEQLSSIEVSQRESCVTLIKHSYQSVLGTKYPLHTINSALQCLSDDELAQIMSSVSDLL 236 zebrafish
2_pfamImport 155 KTITVLLVNPDEcVPPEVRSISEKISGARRSGRDVAITLVLHSFQASLGATCDLRALHAALQTKRDDELDQLAEAVTDHM 234
XP_019213753 161 KTITVLLVSPDDdVPTEVQSVSEQLSVSQHCSRDVTITLILHSFQAALGTKHDLQELHKALQSKQPEELDQILQSLTESM 240 Nile tilapia
XP_015212007 157 KTITVLLMNPSD-IPPEFLAVSEQLSNVRHSQKDAYIILIKHAYQSAFGARYPLDCMQKVLESKKVEELSSIFSDITDIL 235 spotted gar
XP_005256637 159 STVTVLLLNPVE-VQAEFLAVANKLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAELEDIFTETAEAQ 237 human
XP_001366777 159 STVTVLLLNPLE-VQAEFLSVANKMSFPEPSPRSTYVTLLQHVYQATFGVCCDLARLHLMLQSKTVTELEAIFEETTEAQ 237 gray short-tail...
Q5ZIB8       157 STVTVLLLNRSE-VQSEFLSIAEKLSSTEPPRHATLVLLLEHLYQVTFGTRCDLGSLHHLLKAKTLEELSEIYTSAAEAQ 235 chicken
XP_003217124 159 SIITVLLLNPSE-VDGEFLSVAEKMSTTELSQQTLLVTLLEHIYQANFGTKCDLGKLHQILKLKTVEELMELFASTSEAQ 237 green anole
XP_011472108 242 EMAAvMS-DPQKARNHIIKELEELSRSLEISA------SNGRSSDGVLKTLPLPTAKCYMFHWEKDNFDVLNTLLEPDFD 314 Japanese medaka
XP_022530922 253 ESASaMP-DVNEARSHVAQGLEQLKEKLNIPG------CDSKKMDGMLQILRVPTAKCYTIRWDTDNFDVLNELLESEPE 325 Mexican tetra
XP_009300642 237 ESAAaMV-DIAKARKHVEGGLEVLREKLGIPS------SNGKMSDGVLQTLGLPAAKCYTFHWDKDNFDVLNDILDIESE 309 zebrafish
2_pfamImport 235 EAAAsAA-DPETARRALLHVMEKLRDRVAGPAavctdaGMTDDVRGAVETFMLPFPKCHTCSWENDNFDFLKDILSCESD 313
XP_019213753 241 EMAAsAA-DLRSAREGILQSMERLKESLTVPAr-----ADEGTDMGAVDIFTLPFPKCHKCHWENDNFDVLKHILGAQND 314 Nile tilapia
XP_015212007 236 ETAVsVE-DIDKAREHLLEDLERLREKIGLPA------PNSKKSEGMLQTLSLPIARCHTYHWDKDNFDILNEIFQAECD 308 spotted gar
XP_005256637 238 ELASgIG-DAAEARRWLRTKLQAVGEKAGFPG------VLDTAKPGKLHTIPIPVARCYTYSWSQDSFDILQEILLKEQE 310 human
XP_001366777 238 ELASaIR-DPLEARQWLKAKLKAVGERAGFPY------ISETAQSCKLYTIPIPVARCYTCSWNQDSFDILNEILLKERE 310 gray short-tail...
Q5ZIB8       236 EIAAaSS-DPVLARERLQSALRDIAGAAALPT------IAGDAQPRRLQPIPIPTSRCYTYSWDQDNFDVLNDVLSKECS 308 chicken
XP_003217124 238 EIAAvSSdDPSIAREQLESALWEIAKAAELPI------ITDEALPSKLRLIPIPVARCYTYRWDTDNFDILNEVLDKEGY 311 green anole
XP_011472108 315 DLAFSGRATEEKDDEFddeqdatgtdDDKEDKLEKDELSSMSIMsydcygSHRASTLSSLSTT------------SKDSM 382 Japanese medaka
XP_022530922 326 LASIQASEVPAEEDEVde------dvDEEEDLEEMEEFGTLSYM------DPRASMFSTVSSLst---------aSKDSM 384 Mexican tetra
XP_009300642 310 LTLSQTSE-SMEEDDVdnvdveddeyDDLEDVCTD----------------YRASTFSTVSSLst---------aSKDSM 363 zebrafish
2_pfamImport 314 LDSPPDCFLENETDNVikd----tsvDGEDGAEGNKEDHE-----------LHSHRVSTASSS------------SRDSS 366
XP_019213753 315 MDL-SDCFLKTGLDDDdnnd---tsfDEEDELEGNKDDPE-----------FQSHRISTASSS------------SRDSG 367 Nile tilapia
XP_015212007 309 LAEAQPQPDEGEDDEEe-----------EEDVEEEEVAVNGCVD-------HRASTFSTVSILst---------aSKDSM 361 spotted gar
XP_005256637 311 LLQPGILGDDEEEEEEe--------eEVEEDLETDGHCAERDSLlstsslASHDSTLSLASSQ----------------- 365 human
XP_001366777 311 LFQPETLEDEEE----------------EEDLEADGCFAERDSLfstssmAFRDLTRSTASLP----------------- 357 gray short-tail...
Q5ZIB8       309 VVEPVASENEEDEEEE------------EEDVETDGCSPERDSLlspissISKDSVYSALSEDgpkhscvslfssSKDSI 376 chicken
XP_003217124 312 YPKPVLLEDE----------------------EADNCFSERDSL---------------LSEDgpcns--rvsivSKD-- 350 green anole
XP_011472108 383 FST---LSVASESYPA----SLFSVTS-VDS---DYCEDSDDYNSSSP-THEKCSPKS-GKSPGRLS-QHFYRLFnKPKC 448 Japanese medaka
XP_022530922 385 FST---YSVASSECSPlstlSSSSQASgTDS---DFCEEAEEDSPVPP---------TsGKPKSSSGfKRLSRLF-KAKS 448 Mexican tetra
XP_009300642 364 FST---LSVASSECSPlstlSSSSQASgTDS---DFCEDLEDDSSSTV-------SPSkTKNSGRLS-KRISRFF-KPRS 428 zebrafish
2_pfamImport 367 YSLsssHSLSSSWSAV----STPSGSSgVES---DFSEDTDGGPDSRP----KLRKKPkKKSRSILGvERFSLLFkGPRS 435
XP_019213753 368 ------YSLSSSW-------SVPSGSSgVESgeeTTQEDIEERQDSQT----KPRKKPkKKSRSLLG---FSLLFkPPRS 427 Nile tilapia
XP_015212007 362 LSNnsfSSISSSSSGP----SRLSVASgMDS---DFCEDTEEESSTDKt----------PKARARLG-KRISMLF-KSKS 422 spotted gar
XP_005256637 366 ASG---PALSRHLLTS----FVSGLSDgMDS---GYVEDSEESSSEWPwRRGSQERRGhRRPGQKF--IRIYKLF-KSTS 432 human
XP_001366777 358 ASV---PGFSSHLLTS----FVSGLSDcMDS---GYMEDSDESSPDRPrKAESQEEQEsQRPRRKL--NRIYKLL-KSKS 424 gray short-tail...
Q5ZIB8       377 SEL---TVVSKKSLRS----FVSSLKDcMDS---GYAEDSDESSLDTLgRPELKVEKThHKYRHTLT-NKIYKLF-KSKS 444 chicken
XP_003217124 351 SAL---SLVSKKSLKS----FVSSLKDcVDS---GYMEDSDESSPELAgRLDPKEEKMsSRHRHRLS-NKLYKLF-KSKS 418 green anole
XP_011472108 449 PRQ------------------LSRANSLG---NTVSSDLSA-VRETRSNSLPQQVKLCISEP---SNKPSNQALRHVCFR 503 Japanese medaka
XP_022530922 449 SHS------------------LCRAKSLG---NAEAKDILPsVRSKRSNSVPQQALLRSSEVgltESLLMQQALGCVRYR 507 Mexican tetra
XP_009300642 429 SNS------------------LCRAKSLG---SPEAKELVVaVRSKRSNSLPQQVHLRSSDFg--FPVIPLSQLQYVCYR 485 zebrafish
2_pfamImport 436 PGT------------------CRRVQSMGhrqDFPRDVPTAgL---NSLSLCRQVRPLHACA---ATRDPLSPRKHMCVR 491
XP_019213753 428 PRV------------------CRRVQSMAyhkDFQRTQ----SQLKHSK-----VHPLHESP---PPLDPLSPQKHLCVR 477 Nile tilapia
XP_015212007 423 SNS------------------LNRAKSLG---NTEAKDYVT-IRSKRSNSLPQQVHLQSPEN---------MFLRNVCYR 471 spotted gar
XP_005256637 433 QLVlrrdsrsle-gssdtalpLRRAGSLC---SPLDEPVSPpSRAQRSRSLPQPKLGTQLPS---WLLAPASRP----QR 501 human
XP_001366777 425 HLVlrrdsqspvkgassvelpLRRTGSLC---SPLNIPSPPsSCSQRSHSLPQHMLESQLSS---WLHPTATHH----RH 494 gray short-tail...
Q5ZIB8       445 QLVlrrdlkdc---vdtgslpLRRAESLC---HPQAKPRIP-ARSRRAHSLPQHGLGQKLQT----PQTPQLLS----LP 509 chicken
XP_003217124 419 QLIlgkelrdis-evtslslpLRRAESLC---NPVAKDRIP-ARSRRAQSLPQHVLSATLFQ----NHVPQNTC----VQ 485 green anole
XP_011472108 504 RRPILSSDED---DKDVTLRVVVFGADHVAGKVARAYSNLRRKESTCPHLSRVFKLQFYFVPVKRDSVVgaGHRRASGPS 580 Japanese medaka
XP_022530922 508 RRPILSSAETe-ePGATLLRVLVFGADHVAGRVARAYSSLRRKERDCPRLSKAFRLRFFFVPVRRD------PPGNGAVT 580 Mexican tetra
XP_009300642 486 RRPILSTDDEegpTGATLLRVVVFGADHVAGRLARAYSSLRKRERDCPHLTKAFRMKFFFVPVRRD-TA--PVNSRRSSL 562 zebrafish
2_pfamImport 492 RRPIMSCDEGdaqEAPTLVKVVVFGGDKEAGRLARAYSDLQQKESKCPRLTKTCKLRFYLVPTKRRATG--SSGGHASPV 569
XP_019213753 478 RRPILSCNEEdlvEAPTLVKVVVFGGDREAGRLARAYSDLHQKESKCPQLTKVCKLQFYFVPTKRR-SG--SPGGGHTPT 554 Nile tilapia
XP_015212007 472 RRPILSCDED---TKTTTLRVVVFGADQITGKVARAYSNLRLQESRCPRLTRLFKLQFFFIPVKRNSSS--PAVGVSSPG 546 spotted gar
XP_005256637 502 RRPFLSGDED---PKASTLRVVVFGSDRISGKVARAYSNLRRLENNRPLLTRFFKLQFFYVPVKRSHGT--SPGACPPPR 576 human
XP_001366777 495 RRPFLSGDED---SKASTLRVVVFGSDRISGKVARAYSNLRKLESNCPLLTRYFKLQFFYVPVKRSYQP--ISGTSSAPS 569 gray short-tail...
Q5ZIB8       510 RRPFLSYDED---AKVATMRVVVFGSDRISGKVARAYSNLRLKESTCPTLTRYFKLQFFYVPVKRSCLLp-AALLMHPP- 584 chicken
XP_003217124 486 RRPFLSCDEN---TKVSTLRVVVFGSDRISGKVARAYSHLKSQESSCPRLTRYFKMHFYYVPVKRSGPT--SSVLTHPP- 559 green anole
XP_011472108 581 IQTGFQKGLN---LSY-DINPSDVGDSTNDIAHLLGMLDPWYERNTLSLLKLPISVVCKQTSKTESKSYDSSyEQRLPIL 656 Japanese medaka
XP_022530922 581 QFSASPLKASq------DVNMDAPEHSTNDIATLLGMLDPWYERNTLCLLDLPLHIVCKQTSKPEPELLEDSaEDGLPIL 654 Mexican tetra
XP_009300642 563 QLSASPLKTA---ISTtDLCVNRMEDSTNDIANLLGMLDPWYERNTLSLMELPVNVVCQQTSKIDSDLSEGTgEERLPIF 639 zebrafish
2_pfamImport 570 VKSKAVLLSC---FAGrESNGSVLEDGTQDIAQMLGMMDPWYERNVLSLLSLSSDVLFQTACKDDAESVSG--EERLPLL 644
XP_019213753 555 EERIGGLTKT---TTSaDSNGLAVDDCTTDIAHMLGIMDPWYERNVLSLLSLSSDVLSQAASKDDSVSHSNGgTEQLPLL 631 Nile tilapia
XP_015212007 547 SLSDSPGRGS---MAV-DPSLPCLEDSTNDIAQYLGMLDPWYKRNMLSLLNLPVEVLCQQTSKTEPDVSSST-RERLPIL 621 spotted gar
XP_005256637 577 SQTPSPPTDSprhASPgELGTTPWEESTNDISHYLGMLDPWYERNVLGLMHLPPEVLC-QSLKAEAQALEGS-PTQLPIL 654 human
XP_001366777 570 NQSHLMSTESlrhLTPmDITLSSWEDSTNDISHYLGMLDPWYERNVLGLMHLPTDVLCQQTLKTETGPLESA-QEQLPIL 648 gray short-tail...
Q5ZIB8       585 ---PSPSDLQlraLAQaEPTLAGAESSTNDISHYIGMLDPWYERNVLGLMNLPMDVLC-QSAKPEAEPQEDS-REQLPIL 659 chicken
XP_003217124 560 ---PSPGNSHsrtPGAtVLNLAGMESSTNDISLYLGMQDPWYERNVLGLMNLPIHVLCQQSIKPEGEPLEET-SEQLPIL 635 green anole
XP_011472108 657 ADLVLYYCRYAARKTLIQLYQAELTLAGGEKRTEVFVHSLELGHTAGTRAIKAMGAASKRFGIDGDREAVPLTLEVVYNR 736 Japanese medaka
XP_022530922 655 ADLLLYYCRNATRPALVQLYQAELTLAGGEIRTEVFVHSLELGHTAGTRAIKAMGAASKRFGIDGDREAVPLSLEVVYNQ 734 Mexican tetra
XP_009300642 640 ADLVLYYCRHAARPALIQLYQAEFTLAGGVRRTEVFIHSLELGHTAGTRAIKAMGAASKRFGIDGDREAVPLSLEITYNR 719 zebrafish
2_pfamImport 645 ADMVLYYCRHADQPVLVQLYQAELTLAGGERRKEVFIHSLELGHTAGTRAVKAMGSASKRFGIDEEREAVPLTLSVAYNK 724
XP_019213753 632 ADLVLYYCRHADQPVLVQLYQVELTLVGGERRREVFIQSLELGHTAGTRAVKAMGAASKRFGIDEEREAVPLTLSLAYNK 711 Nile tilapia
XP_015212007 622 ADMVLYYCRHAARPVLVQLYQAELMLAGGMKRTEVFIHSLELGHTAGTRAVKASGPVCKRFGIDGDREAVPLTLEIVYNK 701 spotted gar
XP_005256637 655 ADMLLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSK 734 human
XP_001366777 649 ADMLLYYCRFATRPVLLQVYQTELTFISGEKMTEIFIHSLELGHSAAVRAIKASGPGSKRLGIDGDREAIPLTLQIIYSK 728 gray short-tail...
Q5ZIB8       660 ADMILYYCRFATRPVLLQLYQTELTFIGGEKMTEVFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAIPLTLQIAYSK 739 chicken
XP_003217124 636 ADMILYYCRFATHPVLLQVYQTQLTFTGGETRTEIFIHSLELGHSATTRAIKASGPGCKRLGIDGDREAIPLTLQIAYSK 715 green anole
XP_011472108 737 VVISGRSQCKRETKVCTSMNLIKACKNPEELDSKMECLQLTMTEVLKRQSGKSKKGYNQCLNTTEVKVDKVQVSGAR-NT 815 Japanese medaka
XP_022530922 735 VVISGRNQKTRAEKVCTSVNLIKACRNAEELDPKIECLQLTMTEVLKRQNSKSKKSFNQQLSTTRAKVDKVRVCGSG-NT 813 Mexican tetra
XP_009300642 720 IHISGRSQKTRTEKSCTSINLQKACRNSEELDSKMECLRLTMTEVLKRQNSKSKKGYNQQLTTTEVKVDKVQVSGTC-NT 798 zebrafish
2_pfamImport 725 VVVSGRSQWIQKEVVCTSINLHKACRNPEQLDTRIESLQLTMTEVVKRQSSKSKKGYNQQIYISEVKVDKVQVHGGAdGA 804
XP_019213753 712 VAISGRSQWINKEIMCTSINLHKQWRTPQQLDS-AESLQLTMTEVLKRQCSKSKKGYKQHISVSEVKVDKMQVNGRDpGT 790 Nile tilapia
XP_015212007 702 VSVSGRNQWSKVNKICTSVNLTKACKKPEELDSKMECLQLTMTEVLKRQNSKSKKGYNQQLNTTQVKVDKVQVSGAC-NT 780 spotted gar
XP_005256637 735 GAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQ-ISTSQIKVDKVQIIGSN-SC 812 human
XP_001366777 729 GAISGRSRWNNLEKVCTSVNLNKACRKLEELDSNIEALTLTLTEVVKRQNSKSKKSYNQ-ISTSQIKVDKIQIIGSN-NC 806 gray short-tail...
Q5ZIB8       740 TAISGRSQWNDVEKVCTSVNLSKACKKYEELASKTECLNLTMTEVVKRQNSKSKKSFNQ-LSVSQIKVDKVQIIGV--QS 816 chicken
XP_003217124 716 RSVSGRSRWNNTEKVCTSVNLRKACKRQEELGPKTECLTLTATEVIKRQSSKSKKSFNQ-ISVSQIKVDKIQIIGV--NC 792 green anole
XP_011472108 816 TFAVCLDQDEKKILQSVTRCEISVCYKPDSSTDWRLRKSQTTAQIQPINSAFCSLLCLPIVTFSGALP 883 Japanese medaka
XP_022530922 814 TFAVCLDQDEKKILQSVTRCEVSVCYKPDSSANWPRFRTLT-TQVQPLQPTFCSLLCLPISTFSGPQP 880 Mexican tetra
XP_009300642 799 TFAVCLDQDEKKILQSVMRCEVSVCYKPDSSTDWTRGRVFS-SQTQLLQPTFCSLLCLPVATFSGPQP 865 zebrafish
2_pfamImport 805 TFAVCLDQDEKKFIQSVTRCEVSLCSKQGSSSDWKAYKPSP-GQVQPLHPSYCSLLCLPITSFSAS-- 869
XP_019213753 791 TFAVCLDQDEKKFIQSVTRCEVSPCCKPGSGLDWRTYKPLL-GQVQPLHPSYCSMLCLPITSFSSSyp 857 Nile tilapia
XP_015212007 781 TFAVCLDQDERKIFQSVTRCEISVCYKPESGMHWRIRKALSS---QPLCPEFCSLLCLPISTFSGAhs 845 spotted gar
XP_005256637 813 PFAVCLDQDERKILQSVVRCEVSPCYKPEKSDLSSPPQTPPDLPAQA-APDLCSLLCLPIMTFSGALP 879 human
XP_001366777 807 SFAVCLDQDERKILQSVVRCEVSPCYKSENNSLCPQPQRLSFLPPQN-SPDLCSFLCLPIMTFSGALP 873 gray short-tailed opossum
Q5ZIB8       817 SFAVCLDQDEQKILQSVTRCEISVCYRPRDSDPLALRR--SSLTPQD-PSEFHSLLCLPISTFSGALP 881 chicken
XP_003217124 793 SFAVCLDQDERKIMQSVVRCEVSACYKPKISKSSIGGKVMPSFPPQE-PSDFCSLLCLPIATFSGALP 859 green anole
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap