Conserved Protein Domain Family
CENP-F_N

?
pfam10481: CENP-F_N 
Cenp-F N-terminal domain
Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore. Most of the kinetochore/centromere functions appear to depend upon binding of the C-terminal par to f the molecule, whereas the N-terminal part, here, may be a cytoplasmic player in controlling the function of microtubules and dynein.
Statistics
?
PSSM-Id: 402210
View PSSM: pfam10481
Aligned: 11 rows
Threshold Bit Score: 355.689
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001510329    1 MSWAVEEWKEGLSTRALQKIQELESQLDKLKKERQQRQFQLESLEAVLQKQKQKVENEKTEAATLKRENQSLMEMCDNLE 80   platypus
NP_001074832    1 MSWALEEWKEGLPSRALQKIQELEGQLEKLKKEKQQRQFQLDSLEAALQKQKQKVEDGKTEGADLKRENQRLMEICEHLE 80   house mouse
NP_989976       1 MSWAVEEWKEGLSPRVLQKIHELESQVDKLKKERQQRQFQLESLEAALQKQKQKVENEKNETAILKRENQSLMELCDSLD 80   chicken
5_pfamImport    1 MSWVVEEWKEGLPTKTLQKIQELESQLDKLKKERQQRQFQLESLEAAFQKQKQKAESEKSEISALKRENQSLIESCDNQE 80  
2_pfamImport    1 MSWVVEEWKEGLPTKTLQKIQELESQLDKLKKERQQRQFQLESLEAAFQKQKQKAESEKSEISALKRENQSLIESCDNQE 80  
XP_014345462    1 MSWAIEEWKEGLPSKALQKIQDFESQLEKLKKERQQKQFQLESLEAAFQKQKQKVENEKSEVTALKRENQSLVESCDNLE 80   coelacanth
XP_011607922    1 MSWAVEEWKDGLPVKALQKIQEMEVHLDKLKKERTQKQFKLDSLEAALQKQKQKADIERTESSALKRENQSLVESCDSLE 80   torafugu
XP_015207584    1 MSWAVEEWKDGLPGKALQKIQEIESQLDKLKKERQQKQFQLETLEAALQKQKQKMEVEKNEVTALKRENQSLVESCDNLE 80   spotted gar
XP_023357732    1 MSWALEEWKDGLSTRALQKIQELEGQLDKLKKDRQQRQFQLESLEDALQKQKKKVEDQKNEGATLKRENQSLMETCENLE 80   Tasmanian devil
XP_008124054    1 MSWVVEEWKEGLSTKVLHKIQELESQLEKFKKERQQKQFQLESLEAALQKQKQKVDQEKNEGSTLKRENQNLMELCDNLE 80   green anole
TKS69969        1 MSWAVEEWKDGLPGKALQKIQEMEGQLDKLKKERTQKQFQLDSLEAALQKQKQKADSERSETSALKRENQSLVESCDSLE 80   big head croaker
XP_001510329   81 KTRQKISHDLQVKESQVNYQEGQLNSSKRQIEKLELELKRC-----------------KSELE----RGQQALLP---GD 136  platypus
NP_001074832   81 KSRQKLSHELQVKESQVNLQESQLSSCKKQIEKLEQELKRC-----------------KSEFE----RSQQVAQS---AD 136  house mouse
NP_989976      81 KAKQKNSHDLQVKESQVNILSGQLSSSKKEIERLEQELKRY-----------------KCELE----RSQQSLIA---AE 136  chicken
5_pfamImport   81 KAKQKITHEYQLKESQVNFLEGQLSASKKQIEKLEQELKRFvlhlynmceiqlqgiwsQSQKDsfgnKRAAELYSglkRQ 160 
2_pfamImport   81 KAKQKITHEYQLKESQVNFLEGQLSASKKQIEKLEQELKRHr---------------kQCQTD----RRHSQ------SS 135 
XP_014345462   81 KSKQKISHDLQVKELQVNFLEGQLATCKKQIEKLEQEMKRS-----------------KCEIE----RSQQPLLL---GD 136  coelacanth
XP_011607922   81 KSRQKLAHDLGIKEQQVSYLEGQLNSCRKTTECLEQELKKY-----------------KNELE----RSQSAGSS---LS 136  torafugu
XP_015207584   81 KTRQKVTHELQVKEQQVNYLEGQLAASKKQIEKLEQEIKRN-----------------KVELD----RSQQSVAA---GD 136  spotted gar
XP_023357732   81 KMRQKISHELQVKESQVNFQEGQLNSSKKQIEKLEQELKRY-----------------KSELE----RNQLAVLP---GD 136  Tasmanian devil
XP_008124054   81 NTRQKLAHDLQVKELQVNFQEGQLISSKKQIENLEQELKRY-----------------KSELE----KHQKIHVA---GD 136  green anole
TKS69969       81 KARQKVSHDLGVKEQQVSYLDGQLNACRKTIERLEQELKKY-----------------KNELD----RSQPAGSSslsSS 139  big head croaker
XP_001510329  137 SS--LSVS-----STPQKSFTAPLT-PSqyhndAKYKELQEKYNKEVEERKRLEAEVKVMQVQKmn-qaLPQS--TVNHR 205  platypus
NP_001074832  137 VS--LNPC-----STPQKLFATPLT-PS-----STYEDLKEKYNKEVEERKRLEEEVKALHAKKvs-lpVSQA--TMNHR 200  house mouse
NP_989976     137 LS--FS-------GTPQKSFTAPLT-PVqshndAKFEELEEKYKKEVQERKKLELELRTIQVKKinqpyLQQS--SLSHR 204  chicken
5_pfamImport  161 MA--LSVL-----YSPTSq--------------AIFSIL--------------------TNVPQpp-qaAAQS--TMTHR 196 
2_pfamImport  136 MS--LSPLsighcQGPTSVIALPCSpLIywkctALFPTLEERKGHKA---KKIALEIREVSIKNpp-qaAAQS--TMTHR 207 
XP_014345462  137 ----LQPC-----ATPEKNFAVPVA-PSrnyndSKVEELQEKYNKEVEERKRLEAELKIMQAKV-----VNQSqgNVNRR 201  coelacanth
XP_011607922  137 SSseLQPY-----TTPQKSIPTPLPvTAnrhqdNRLEGLEEEYNLEVKERKKLETELKVLQVKLe---nQSSA--TVSHK 206  torafugu
XP_015207584  137 ----QQSY-----GTPQKSFATPAT-PSqklhdSKLEEIQEKYYKEVEERQKLEAELKVMQIKl-----LNQS--SVSHK 199  spotted gar
XP_023357732  137 VSt-LN-------STPQKSSAPPVQssq---saSRYEELQEKYSKEVEERKRLEEEVKALQIKKas-ktVPPN--NMSHR 202  Tasmanian devil
XP_008124054  137 VS--FN-------STPQRNLITSST-Psd--ndSKYEELQAKYSKEVEERRRLEAELKSLKSQKtn-ttCPES--MISRR 201  green anole
TKS69969      140 SSe-LQPY-----TTPQKSFSTPAPvAAyrqqdNRLEELQEKYSQEVEERKRLETELKVLQVKL-----LNQSsvTVSHK 208  big head croaker
XP_001510329  206 EIARHQTSSSVFSWQ-QEKTPNRFSANIQETPLKRGFSAchfPWEq-EETPNKPERKEa-----NTSICDNSCNSQLMDQ 278  platypus
NP_001074832  201 DIARHQASSSVFPWQ-QENTPSRLSSDALKTPLRRDGSAahfLGE--EVSPNKSSMKTgr--gdCSSLPGEPHSAQLLHQ 275  house mouse
NP_989976     205 EIARHQASSSVFSWQ-QEKTPSR----NQETPAKRTSSTpyfPWEk-EGNSSIKSEKNk----fDNSFSEDC-NSLLINQ 273  chicken
5_pfamImport  197 DIARHQTSSSVFSWQ-EDRTPSHPSSTSHDKRLKRSFASsqlLWDq-EETPSKRGVRSenlgksAS----DSYTTQLNDQ 270 
2_pfamImport  208 DIARHQTSSSVFSWQ-EDRTPSHPSSTSHDKRLKRSFASsqlLWDq-EETPSKRGVRSenlgksAS----DSYTTQLNDQ 281 
XP_014345462  202 DIARQQASSSVFPWQ-QEQTPSHAASNSLETPSRRGCTTshfPWEr-EETPSMYCQRSakktasNSSFNESSSNSPQNDL 279  coelacanth
XP_011607922  207 DFVARQAGSSIFPWQ-QDQAHSWQIQDAVETPVKRRGTS---LWDvhEETPIKPSQRMs-------SLQSPARSCQQMEQ 275  torafugu
XP_015207584  200 DIARQQTQSSIFPWQ-QDQTPSRQSHSFLETPLKRGIGAssfLWDh-EETPYKRNs--------RSTLHDNAGSSQQSEQ 269  spotted gar
XP_023357732  203 EIARHQSSSSVFPWQ-QEKTPTRHSANAQETPFRRGFTAlhvPWEq-ETTPNRMPSWQd----tNCSFHENPSDPHLLDQ 276  Tasmanian devil
XP_008124054  202 EIARQQASSSVFSWQ-QEKTPSRFSSSPQETPISSGSVTshrSQEf-GATPSHRYLKStkkgmsNSGIFSSKDSPLL--K 277  green anole
TKS69969      209 DIAARQAGSSIFPWQqQDAAHSRQSQDAMETPLKRRATS---LWDahEETPIKSSQRMs----cSRSVQSPSGSSQQMEQ 281  big head croaker
XP_001510329  279 LKAQNQELRSEVSELERLLQGQEKD 303  platypus
NP_001074832  276 AKAQNQDLKSKMTELELRLQGQEKE 300  house mouse
NP_989976     274 LRAQNQELNSTIKDLEQQLQALEKE 298  chicken
5_pfamImport  271 LKTQNQELKSRINELEMRLQVQEKD 295 
2_pfamImport  282 LKTQNQELKSRINELEMRLQVQEKD 306 
XP_014345462  280 LKVQNQELNSKVTELELRLQAQEKE 304  coelacanth
XP_011607922  276 LKTLNQELCGRVSELERILSTQQKD 300  torafugu
XP_015207584  270 LKAMNQDLKAKVSEMELCLQAQDKD 294  spotted gar
XP_023357732  277 IKAQNQELRFKVNELEHRLQGQEKD 301  Tasmanian devil
XP_008124054  278 MKAQNqELRSRIQELEHKLQSQTQD 302  green anole
TKS69969      282 LKTINQELRGRVSELERNLSTQEKE 306  big head croaker
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap