Conserved Protein Domain Family
Vps54_N

?
pfam10475: Vps54_N 
Vacuolar-sorting protein 54, of GARP complex
This is a family of vacuolar-sorting proteins 54, from eukaryotes. Along with VPS52 and VPS53 this forms the Golgi-associated retrograde protein complex GARP. VPS54 is separated into N- and C-terminal regions each of which has a different function. This N-terminal family of is important for GARP complex assembly and stability, whereas the C-terminal domain, pfam07928, brings about localization to an early endocytic compartment.
Statistics
?
PSSM-Id: 402208
View PSSM: pfam10475
Aligned: 10 rows
Threshold Bit Score: 369.363
Threshold Setting Gi: 82082314
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q54MU4         72 LKITPAGFFDP--KFDTTqFILDLLPPN---VNNSSsefsifLDSNVKQFTRAMDYVNSKLYNRVRENYTEFVQGMSQIH 146  Dictyostelium...
Q54NV0        113 IDSLDEVYFKE--DFDPA-FILQNIPKD---APIDT------IDALTVKISGYHEAVDSRFNDLIRKSYNGFVQGMSQVY 180  Dictyostelium...
Q336V4        131 VDELEEVFFQE--EFDPIkYILQSIPAEg-dSSY--------FDKQSTLRLAQLDKIAERLSHHVMGHHEEMVKGMQLVM 199  Japanese rice
Q8RXC2        132 VEELEEGFYEE--DFDPVrHILENVPDDeseLAY--------FEKQATLRLVQLDKVAETLSHHVMEHHEVMVKGMNLVR 201  thale cress
Q18602         76 INSIDAAYFIDndEFDAIdYELKKLCDIe--MCYED------IQRERFRLKSQHTVVSKKISTLIMQKSSSYTAQVGEME 147  Caenorhabditi...
XP_002642305   80 IDSIDASYFIDndEFDAIdYELKKLCDId--MCYED------IQRERFRLKSQHTVVSKKISTLIMQKSSSYTNQVGEME 151  Caenorhabditi...
Q5ZKV9         54 INSIEEVYFSNd-AFDIVkYELERLPPV---LSLQE------LEEYRDKLKQQQ------------------AAELERVT 105  chicken
AHL21633       75 LESIEQCYYNP--DSNPQlYELKKVLNDg--IDNEL------IEVTIAQLRTQQKVLTKQVLQNILEQRNACSSEFAAIN 144  fruit fly
Q7QF78          6 LESTEAIYFDG--GSNTGlHELRKLSESgqlLDCGS------IEQSMGVLRRQHRVISKKVLQLILEQRAACDGEFQRIR 77   Anopheles gam...
Q16RR9         70 LESTEAIYFDS--GSNTGlHELKKLSETdelLNCQC------IEKAMGTLKQQHKVISKKVLQLILEQRPACNEEFQRIQ 141  yellow fever ...
Q54MU4        147 EIGVELQRSTVMCSNGRRTLSQTKKNLTQTAFIIMSKYTKRNLLTKMYMDLSQIREIVHLERLLKQTLSDGDYPATIKYY 226  Dictyostelium...
Q54NV0        181 EIEKDLTHSARMCTSGKEYLDGIQKNMTLFGFRLLAKHRIRQLSKFMYQESHIIKEISDAAKKIDMLLNMNEFSQALDLL 260  Dictyostelium...
Q336V4        200 ELEQDLKVANVICMNGRRHVSSSKNEVSR-DLVVNVKSKKKQALLDVLPILTELRNAQDMQMELESFVEKENYFQAFQLL 278  Japanese rice
Q8RXC2        202 ELEKDLKIANVICKNGRRNLTSSMNEASR-DLIVHTHSKKKQALLDMLPILTDLRHARVMQSNLEDLVEDGNYCKAFQVL 280  thale cress
Q18602        148 KIRDEVGSVINEILTIRKALALATSQ-TRTCLGLIAYKNKKIVLNQLKMTLTTIKGFHETEQHIRETIEEGNFPLAIQML 226  Caenorhabditi...
XP_002642305  152 NIREKVNGVVDEIISIRKALALATDQ-TRTCLGLIANEYKKASLHKLKTTLTTIKSFHEAETRIRETIQEGNFPLAIQML 230  Caenorhabditi...
Q5ZKV9        106 SLQNGLQLAAVICADGRRHLNIAKEGFTQTSLGLLANQRKRQLLIGLLKSLRTIKTLQRTDVRLSEMLEEEDYPGAIQLC 185  chicken
AHL21633      145 DTQKKLEESLWTCQKARSYLNFARTNLTTTSLEILASYRKREVLKEVLDTLVAIKRLRTTDVEVQKLLADHNYSAAIALL 224  fruit fly
Q7QF78         78 DTERLLRDTVTMCRAARTKLDTSKLLLTTTNLEILAAYKKRQTLVNLLRTLNALKSMRSIDQRLQRRLTDADYGGAIAIL 157  Anopheles gam...
Q16RR9        142 ETEGLLRETIAKCRTTRNHLDGSKKLLTTTNLEILAAYKKRQTLINLLKTLNALKSMRSIDQRLQKHLSEADYSGAISIL 221  yellow fever ...
Q54MU4        227 LECRRTITQHLHYNCVPDLDKNLQEIYHVVQERIDKDFLISCRDFNSTTYSRVFQAYKLLGRANRILDKLQSYFVDPIEP 306  Dictyostelium...
Q54NV0        261 NQWNQVITKYSKYTCIKDISSSIQVNADSVLDKIDSSLHSVCHNFDPKQFDIIMNSYFKLKKFQRIKDKIHQNFILNIED 340  Dictyostelium...
Q336V4        279 PEYLQILENYSGLSSVQEMGRGIEAWLARTIQKLDTHLLGVCQTFHEESYLTVIDAYALMGDIGGMAEKMQSFFLQEVLS 358  Japanese rice
Q8RXC2        281 SEYLQLLDSLSEFSAAQEMTRGVEVWLGRTLHKLDSLLLGVCQEFKEDSYVMVLDAYALIGDVSGLAEKIQSFFMQEVIS 360  thale cress
Q18602        227 IETQIKAGGYAHFTCVNEVISKLAGMSCLLEAELSAQLSTIAVVFDSEKYRFVYTAYEMLEKTEQVAEKLLTAFVEAIET 306  Caenorhabditi...
XP_002642305  231 IETQIQATGYGQFNCVNDILSKMMELSTLLETELATQLSTIAVVFDSEKYRFVFTAYEMLEKTDHVAEKLLNVFTDAIET 310  Caenorhabditi...
Q5ZKV9        186 LECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHN 265  chicken
AHL21633      225 LQCKSSAEAYMQFNCVQSLSKKLQETMLLMEFQLDTVLNEMVLGFDGRKYAKLQEAYKLANKSLMAMDQLHINYISAIHS 304  fruit fly
Q7QF78        158 LENKNLSQRFHQYRCVESLSHKLQDTLLLTEVQLESVLGEMPSEFEPARYQKLQEAYQLLGKQLIAMDQLHMNFVSSVHT 237  Anopheles gam...
Q16RR9        222 LENKNLSERFQQYNCIESLSTKLQDTLIMSEIQLEAVLNEVPVDFDAKKYSKLQEAYKLLEKQLIAMDQLHMNFISSIHT 301  yellow fever ...
Q54MU4        307 ETRNIVYSHVLLAEEnimNPERVKGLGYKELCRELKDDHFVNCLLAVFEYLCDLMASLYLMNQF 370  Dictyostelium discoideum AX4
Q54NV0        341 HSKKILKTHLNLTYS---KPEELLHMKFVDMCQHLKEDQYIPSLMGILEHLSDLMWSHYMMKQW 401  Dictyostelium discoideum AX4
Q336V4        359 QTHYVLKEMLEEEVG---NNTQRNRFTYSDLCAQVPEPKLRPCLLRTFQSLFSLMCSYYTIMSF 419  Japanese rice
Q8RXC2        361 ETHSVLKSIVGEDNS---AATQYSRLTYSDLCLQTPESKFRQCLLRTLAVLFQLIYSYHEIMSF 421  thale cress
Q18602        307 TTSAVVLSKLK-------EEDRLEDSSYTSLCLKLDSEQASITFREMGFVLCRSFQAFHKILNF 363  Caenorhabditis elegans
XP_002642305  311 TTTAVVMDKMK-------EEDRKDDATYTSLCLKLDGEQASTTFREMGFVLCRSFHSYHKVLQY 367  Caenorhabditis briggsae
Q5ZKV9        266 TVFQVVLGYVELCAGn--TDTKFQKLQYKDLCTHITSDSYIPCLADLCKALWEVMLSYYRTMQW 327  chicken
AHL21633      305 SVNAVLRGYSDP------GQDDQAKPLYEQLCEQLSVDKLLPCLISLCKTFWTILASYYQVVMW 362  fruit fly
Q7QF78        238 AAFTVLRQHMEV------SVEESKKLTYEQMCECVPMDRYVHCLTELCRAFWKILVSYHQIRCW 295  Anopheles gambiae str. PEST
Q16RR9        302 AAFTVLKQHMEAS-----LEDNKQKLTFEQMCENVPCEKYIHCLTDLCRGFWKILVSYYQVRCW 360  yellow fever mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap