5JXF


Conserved Protein Domain Family
Peptidase_S46

?
pfam10459: Peptidase_S46 
Click on image for an interactive view with Cn3D
Peptidase S46
Dipeptidyl-peptidase 7 (DPP-7) is the best characterized member of this family. It is a serine peptidase that is located on the cell surface and is predicted to have two N-terminal transmembrane domains.
Statistics
?
PSSM-Id: 402199
View PSSM: pfam10459
Aligned: 39 rows
Threshold Bit Score: 522.192
Threshold Setting Gi: 123528407
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5JXF_C            36 QQGgMWIPSLLsgmnETEMKN-LGMKISADDIYSVNHSSlkdavPHfNGGCTSEVISPKGLILTNHHCGFDAIQNHSSVD 114 Flavobacter...
Q1DDZ2            19 DEG-MWTYDAFp---SDTVNKaYGFTPTQAWLDHVRLGS-----VRlAGGCSASFVSPEGLVMTNHHCIRGCIEDLSSPK 89  Myxococcus ...
jgi:Anae109_3411  38 DEG-MWTYDAFp---ADKVEKkYGFRPSDAWLENARLSS-----ARlAGGCSASFVSEDGLVMTNHHCAHECIEQLSTAQ 108 Anaeromyxob...
Q2IEV3            19 DEG-MWTYDAFp---SDRVARkYGFDPSRAWLDRARLAS-----ARlARGCSASFVSDGGLVMTNHHCVHECVEELSSAG 89  Anaeromyxob...
Q7NHA9            35 EEG-MWTYDNFp---SEQVAKkYGFKPDAAWLERVRLAS-----LRlAGGCSGSFVSPNGLVMTNHHCAATCIEELSTAQ 105 Gloeobacter...
Q1D5W7            36 DEG-MWTYNNFp---SAKVKEkYGFEPSQQWLDNVRLSS-----ARlAGGCSASFVSANGLVMTNHHCARGCIDQLSTAK 106 Myxococcus ...
mpitm:STAUR_4317  19 DEG-MWTYNNFp---AAAVKAqYGFEPTAQWLDKVRLSS-----ARiAGGCSASFVSANGLVMTNHHCTRGCIEQLSTAD 89  Stigmatella...
Q1IPC2            28 DEG-MWLFTNPp---TAAIQKkYGFAITQEWLDHLRLSS-----SR-APGGSSEFVSPDGLLMTNHHVAQSCIHDLSSGG 97  Candidatus ...
Q7UKL5            29 DEG-MYLFNDVp---RELLRDrHQFEPSEEWLKHLQLSS-----VRfNSGGSGSFVSSNGLVLTNHHVASDTLAKLSSKE 99  Pirellula sp.
Q2S133             6 DAGrIWSLVAPp---ADRLVRrYGMEVDSAWAAHLRRSV-----LR-LPGCTGALVSADGLALTTARCVRRHLNSQGDT- 75  Salinibacte...
5JXF_C           115 HDYLTNGFWAMKMEDELPNENLVVTFIVSINDVTAQILDGVAsiTSETEKQNKIQENITKVTASFAKEA-WQENKVRTFF 193 Flavobacter...
Q1DDZ2            90 KDLLAKGFYASSAAQELRCPKVEANQLVEMTDVTAKMNAATKg-LTGAAFNTALKKETAAVEAACATSG-DVRCDVVTLF 167 Myxococcus ...
jgi:Anae109_3411 109 KDFVKSGFYAKTLPDEVKCPTVEVNQLVQITDVTQRIRAATKg-LEGEAYHKALQGEMAKAEKECQTSD-ELRCDVVTLY 186 Anaeromyxob...
Q2IEV3            90 RDLVASGYLARSGAEELRCPAMQVDQLLRITDVTKRVHGALAg-LEGARFNAALQAQKAAIEKECQGGDaGLRCELVELY 168 Anaeromyxob...
Q7NHA9           106 QNYIESGFLARRPEAELKCPDVELNQLTAIEDVTERVKKATAn-LSGQQFSDAQKAEFARIEKACADAT-GLRCDVVNLY 183 Gloeobacter...
Q1D5W7           107 KDYIANGFYAKAQGEETQCPAMEINQLVKITDVTETLNKATQg-LTGKKYADTLKAKMSELEQACSAGNaKARCDVVTLY 185 Myxococcus ...
mpitm:STAUR_4317  90 KDYIANGFYAKAPTDELKCPAMEINQLAEITDVTDRLNTATQg-RTGKEYSDTLKAEMAKIEKECATSD-QVRCDVVTLY 167 Stigmatella...
Q1IPC2            98 KDYMKDGFYAATREQEPKCPGIEFLVLTDIKDVSEQIHSAVKarMASAESGKATRQAMSAAEKACSTE--GFKCDVVTLY 175 Candidatus ...
Q7UKL5           100 RNLIDDGFLAKSFDEELKAPDLELNQLISIEDVTDRINQQITnaDDAEEAAKERRAAIATIEKESLDET-GLRSDVVTLF 178 Pirellula sp.
Q2S133            76 ------AIVAARPADERAVPALHADRLVRTSDVTAAVRTARQd-TAKAAAISAVQGRLQTEAES------GRHVEVAADG 142 Salinibacte...
5JXF_C           194 EGNQYILFVTEVFKDVRLVGAPPSLIGKFGSDTDNWVWPRHTGDFSMFRVYANKnnhpaayskdNVPYIPKHFLPVSLDG 273 Flavobacter...
Q1DDZ2           168 NGGKYHLYKYRRFQDVRLVFAPEFSMAAFGGDPDNFNFPRFGFDAAFLRVWQD-----------NAPAKSPHFLPWAKQG 236 Myxococcus ...
jgi:Anae109_3411 187 QGGVYDLYKYRRFQDVRLVFAPEFAIAFFGGDPDNFMFPRYDLDVAFLRVYQG-----------GKPAKMKNFFRWSAKG 255 Anaeromyxob...
Q2IEV3           169 HGGVYSLYQYRRYDDVRLVFAPEFAIAFFGGDPDNFMFPRYDLDVAFIRVYRD-----------GKPAPTAEHFTWSPAG 237 Anaeromyxob...
Q7NHA9           184 QGGLYNLYKYKRYQDVRLVFAPEFRIAFFGGDPDNFNFPRYDLDVTFLRAYDK-----------SQPVKTEHYLPLSPTG 252 Gloeobacter...
Q1D5W7           186 QGGQYNLYEYKRFQDVRLVMAPEHAIAFFGGDPDNFEFPRYDLDVTFLRVYED-----------GKPATTNNFFKWSDKG 254 Myxococcus ...
mpitm:STAUR_4317 168 QGGKYNLYKYRRFQDVRLVFAPEHAIAFFGGDPDNFEFPRYDLDVSFVRVYQD-----------GKPAPQDNFFKWSKAG 236 Stigmatella...
Q1IPC2           176 AGAMYHLYKYKKYTDVRLVFAPEFQMAFFGGDPDNFTFPRYDLDITFFRMYEN-----------GKPAHTENYLKFAKKG 244 Candidatus ...
Q7UKL5           179 GGAKYHLYRYKKYTDVRLVWAPETAAAFFGGDADNFEYPRYNLDATLMRVYED-----------GEPAKLEHFLKWNDQP 247 Pirellula sp.
Q2S133           143 EGA-YTAYTYRRHEDVRVALLPDRRISAFGGTDAALTYPRSAFDVALLRIYTSE----------GQPLAPNHFFDPSGQG 211 Salinibacte...
5JXF_C           274 VQEDDFTMVMGYPGKTQEYLPSFAVAQIVNETNPAKIEIREAALKVQDGFMRKDNAIKIQYASKYAGVANYWKKWIGESQ 353 Flavobacter...
Q1DDZ2           237 AKEGDLVFVSGHPGGTERKATVAELEFQRDVNLPYTLLQLAELRGMLREYAGGSAERYRTTRSMLRGVENGLKALRGRHQ 316 Myxococcus ...
jgi:Anae109_3411 256 AEAGELTLVSGHPGGTDRGLTTAQLAMQRDVVLPDRLQSLAELRGLLTGYQLLGPEQKRTSNALLFYVENGYKALRGRHL 335 Anaeromyxob...
Q2IEV3           238 APAGALTFVSGNPGKTERLLTVAQLEYVRDRALPDSLERLAEERGLLTGFQLTGPEAKRVSTSRLFYNENSVKARRGQLA 317 Anaeromyxob...
Q7NHA9           253 PKAGELVFVSGSPGSTSRLFTVAQLEFLRDVVFPESLKRRAELRGVLTQFARQGPEQRRISQETLFGVENSFKAINGQQQ 332 Gloeobacter...
Q1D5W7           255 AQEGELTFISGHPGRTSRGLTIAELEFQRDVVLPKTLMTLSEMRGMLTEFGRRGAEQRRISTNLLFGVENSVKALKGRHE 334 Myxococcus ...
mpitm:STAUR_4317 237 AKEGELTFVSGHPGRTSRGLTIAELEYQRDVVLPKTLMLMSEQRGLITEFQKRGPEQKRISNNLLFGVENAVKAQKGRHE 316 Stigmatella...
Q1IPC2           245 VKEGDLLFVSGHPGRTSRLLSIAELEYLRDVQYPWQIKNLTRRVNLLLAFSKEGAEQAREAEHDLFSFQNSQKALTGYNT 324 Candidatus ...
Q7UKL5           248 AKDGDLVFVSGHPGRTQRIFTVEALEYLRDKRLPHVLDLLRRKEVLLQQYRLEGKEAARRGRDELFGIQNARKAYSGMLT 327 Pirellula sp.
Q2S133           212 ARPGDAVFSAGLPTAPHRAESAAQLATRRDLVLPARRDRLETRAQAL-RARLDTTEASPPQRSALRDAKRALKQTRARLE 290 Salinibacte...
5JXF_C           354 GLKKSNAIGLKQNFEKDFQQKVIAAGKQn-eYGNLLADFQKYYTEITPYAVSRDYFNEVVV----KNteLLSLGYKLYQL 428 Flavobacter...
Q1DDZ2           317 SLADPALLAGKRQDEAALRQKVDANAQVkaaTDGAWDEITQALDAYRRMLPDYRMKEAGDA----YPseLFRMARHLVRV 392 Myxococcus ...
jgi:Anae109_3411 336 ALQDRAFFRSLVESEETLKAQLAKAPAGkdaL-AAFDAIAQAQQRLLQIRDEYNALEGGFR-----NstLFGMARDLVRG 409 Anaeromyxob...
Q2IEV3           318 ALRDPAFFASKVAEENRLRAALRRDPAKarkYLPAWDRIAAAQVRARALDVPYDWLELFPSgrtrIGgdLFWMARHLVRA 397 Anaeromyxob...
Q7NHA9           333 ALLDREFFGRKVAAEQKLRAAVARDPALerkYGKAWDEIALIEKRYETFYRPYLLVERGAA----FNskLFDIARTLVRA 408 Gloeobacter...
Q1D5W7           335 ALLDKTFFAQKVAAEQDLRKKVEANPEMkkkYAAAWDEIAKAQAQLRNIRQDLTFMENGGG----LSstLFQVARTLVRG 410 Myxococcus ...
mpitm:STAUR_4317 317 ALLDKAFFAQKVAAEQELRQKVNASPELkkkYGAAWDEIAKAQEQLKHIRKELNFMEKGQG----FSsqLYNIAMTLVRA 392 Stigmatella...
Q1IPC2           325 FFANKEGWAKKQADEKQFRDYVKAHAERekeFGDPWTEVNQAEGTQRGMFFDYQYVEMLAG----LRgsLAADARFIVRA 400 Candidatus ...
Q7UKL5           328 GLQDPQTFVSKRGRQDRLLTALSKSPEHsglA-DAWKEIAEVQTEKAELLDRSVSLRs----------eLFQLALQILIL 396 Pirellula sp.
Q2S133           291 ALRNEYVRARLAQRDERLRRALRRDPALqrrFGGVLDSLAAIQNTKRTLGAGYRAFGAAEG----GPh-GSSTYRRLLRe 365 Salinibacte...
5JXF_C           429 EQVFI----TKGEQAFNDRKENLIKSQADFFKDFNSTVDEKVFEQLVALYATKAPkeFlPISLLNVE---YKKFAPSIYS 501 Flavobacter...
Q1DDZ2           393 AEEKErpnaERLREYTQSQLPTLEQQLLRD-APVTPELDQALLTFGLTRVRETLGadD-PFVQQVLGreaPADLARTLVR 470 Myxococcus ...
jgi:Anae109_3411 410 AVERPkpnpDRLREFRESNLPALTQELFSQ-APIYPEFEALLLGHSLTKIRERLGtdH-PTVKKLLGkesPQEVAKRVVE 487 Anaeromyxob...
Q2IEV3           398 AEERKkpdgERLKEYRDTALPSLADSVTSS-APIDAAYETVRLGFWLEKVRERLGtdH-PAVKHALGtasPAEIARKAVA 475 Anaeromyxob...
Q7NHA9           409 AQERPkpneKRLREFRDSALPSLTQSLFSE-APIYGDLDEVTLTFSLTKLREYLGtdD-PLVRQVLGkesPEEVARRLVQ 486 Gloeobacter...
Q1D5W7           411 AEEFPkangERLREFNQANVPALEAQLFSP-APVYPELEIARLTFSLTKMREELGsdH-PFVKKVLGkesPEKLAARLVK 488 Myxococcus ...
mpitm:STAUR_4317 393 ADELPkengVRLREFTDAALPGLKAQLLSP-APIYPELEIARLEFSLTKLREELGadH-PFVKKVLGkesPLTLATRVVN 470 Stigmatella...
Q1IPC2           401 AQQRTlpndQRLRGYTDSALATREQELFSD-APAYKDLNKAMLADSLADMQEQEPk--nPSLLKVLAgksPKDRAAELID 477 Candidatus ...
Q7UKL5           397 SEEDRkpneERLPGYTDSGRESLMAQLLSP-APIYDDLEMVKLADEIALLLESRGmnD-SIVQEVLAgrsPKQVASELVT 474 Pirellula sp.
Q2S133           366 ---------ERQESPTRTASSHASMTAADSLQSSSGPVETALLAARLEALRRHLRpdT-AAVGRLLGgqsPAERAASVVE 435 Salinibacte...
5JXF_C           502 KSKLVDYANFKALLSGdAKAVLKKiSLDKGYAFVKSLaDNYSKNIAPRYDEINLKINALQRIYMKAQLELYpnSRIFPDA 581 Flavobacter...
Q1DDZ2           471 GTKLRDVKVRAALLKG-GKAAVEA-SKDPMILFARKVdAEARAARKRYEDTVEAVLKRNGERIAKAHLAVYg-TSGYPDA 547 Myxococcus ...
jgi:Anae109_3411 488 GTKLRDVAVRKRLWEG-GEAAVKG-ANDPLLALAAAVdADARAIRRTFEDEVDSVVKKNHERIAEARFAVQg-RTNYPDA 564 Anaeromyxob...
Q2IEV3           476 GTALRDPAVRKALWDG-GAAAVEA-SKDPLIALARATdADARAIRTRWEDEVDSVETRNQALIAQARFAAYg-RSIYPDA 552 Anaeromyxob...
Q7NHA9           487 GTKLTNVALRKLLWEG-GAAAVAA-SSDPMIRFAVAVdPAARALRLRYEREIEGPVNQNSELIAQALFAQTg-TSVYPDA 563 Gloeobacter...
Q1D5W7           489 GTKLRDVKARQALYKG-GKAAIAA-SKDPMIQLAVALdPDMRAVRKSYEENVESVIRKNSELVAKSKFEIYg-TNQYPDA 565 Myxococcus ...
mpitm:STAUR_4317 471 GSQLRDVAFRQQLFDG-GKKAISG-SKDPMIELARLVdPDARAIRKNHEDNIDSVIRKNSELVAKAKFEVYg-TNVYPDA 547 Stigmatella...
Q1IPC2           478 GSKLDDAAYRKKLYDG-GLKAVEE-STDPLVVMMRSIePQALALRQKFDDEVDPKLRDGGAKIAKVRFAIFg-QTQPPDA 554 Candidatus ...
Q7UKL5           475 GTKIKDIETRKALIDG-GLDAVLA-SKDPMIRLARVIaPEYRRI-DKINEQLSEREKQAYAEITQATTAIEg-TGGYPDA 550 Pirellula sp.
Q2S133           436 QLASASGDGTDAFP-----------TDGPAADVAAVVgARARSFHEQW-RGLTRAERRLTRRLADARRAARs-APVLTDG 502 Salinibacte...
5JXF_C           582 NSTLRVTYGKVKGYSPKDAiYYNPTTYLDGAIEK--YiPGDYEFDVPKKLIDLYNNKDygqygenGKLPVCFIGTNHTTG 659 Flavobacter...
Q1DDZ2           548 TFTLRLNPGQVKGWDENGR-PVAALTTFGGAYERh---tGKEPYKLPDTWLKARGKVP-------PQTPFDVATTNDIIG 616 Myxococcus ...
jgi:Anae109_3411 565 TFTLRLSYGAVEGWLEKGT-PVEPFTVFAGAYERh---tGRDPYALPESWLTAKERLD-------LRTRFNFVTTNDIIG 633 Anaeromyxob...
Q2IEV3           553 TFSPRLSYGQVKGWKQDGR-EVPPFTTFAGAFERh---tGSEPYALPKSWLDAKPRLD-------LATPLDFVTDNDIIG 621 Anaeromyxob...
Q7NHA9           564 TFSPRLSYGAVEGYEHNGR-RVEPFTDMAGAFERa---tGKDPYALPPSWLAAKDRLN-------LATPFNFVTTNDIIG 632 Gloeobacter...
Q1D5W7           566 TFSLRLSYGAVKGYSENGK-QVSPITQMAGTFEHa---tGEEPFALPKSWLKNEKALD-------GTTPMNFVSTNDIIG 634 Myxococcus ...
mpitm:STAUR_4317 548 TFSLRLSYGSVKGYVEDGK-KVTPITVMSGTFDR--H-TGEAPFALPKSWLDAKSKLK-------ASTPMNFASTNDIIG 616 Stigmatella...
Q1IPC2           555 TFTLRLSYGPAKGYEENGK-HIPWSTTMDGAYKHaaDhGNKSPYELPKSWMDAKGKFD-------GNTPFDVVTTADIIG 626 Candidatus ...
Q7UKL5           551 TFTLRLAFGVVSGYEERGE-QIKPTTNFAGAFTHakEhEGQEDFDLPESWMSAKEKID-------LETQLNFVCTADIIG 622 Pirellula sp.
Q2S133           503 T-APRLTDGRVRGYPYNGT-TAPPFTTVFGLYERnrAfGGETPWALPERWHKAGERMD-------RSTPLTLVASVDGAV 573 Salinibacte...
5JXF_C           660 GNSGSPAVDAQGNLIGLNFDRVWEGTMSDIHYDPSICRNVMVDMRYVLFIVDKFAGAKHLINEMK 724 Flavobacterium psychrophilum
Q1DDZ2           617 GNSGSPLVDRDGRVVGLIFDGNLHSLGGRYAYVPETNRAVAVHGEGILAGLEHVYGARRVVDELR 681 Myxococcus xanthus DK 1622
jgi:Anae109_3411 634 GNSGSPMINEKAEIVGLVFDGNIHSLGGDYGFDPAVNRTVAVHSDAIVEALTKIYGAERVVQELR 698 Anaeromyxobacter sp. Fw109-5
Q2IEV3           622 GNSGSPVFDRDLRIVGLAFDGNLASLGGDYGFDDSANRAVAVHSSAILHALARIYGADRLVSELG 686 Anaeromyxobacter dehalogen...
Q7NHA9           633 GNSGSPVIDSRAQAVGLIFDGNIHSLGGAFGFDAALNRAVAVDSRALIEALRAVYGAGALVDELQ 697 Gloeobacter violaceus
Q1D5W7           635 GNSGSPVINKDAEIVGIVFDGNIQSLGGEYGFDESVNRSVSVHSQAIIESLTKIYGATRLLEELR 699 Myxococcus xanthus DK 1622
mpitm:STAUR_4317 617 GNSGSPAINKDAEIVGLIFDGNIQSLGGEYGFNESVNRAVSVHSEAIIESLKTVYGATRVIDELR 681 Stigmatella aurantiaca DW4...
Q1IPC2           627 GNSGSPVVNTNGELVGIIFDGNIESLPLNFMYDDLQARAVHVDSRAILESLQKIYHADALYEEIT 691 Candidatus Koribacter vers...
Q7UKL5           623 GNSGSPVVDRDGVLVGLIFDGNIQSLTSDYLYTNVQSRAVSVSGVAIPEALRSIYQANELADQLG 687 Pirellula sp.
Q2S133           574 SNNGAPLLNQSLELVGVAAGPNIQGVAGAYLFLPERMRTVGTDVRGLREALTAVYGADALVDELF 638 Salinibacter ruber DSM 13855
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap