4WWU


Conserved Protein Domain Family
Mtr2

?
pfam10429: Mtr2 
Click on image for an interactive view with Cn3D
Nuclear pore RNA shuttling protein Mtr2
Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts. Transport across the nuclear-cytoplasmic membrane is via the macro-molecular membrane-spanning nuclear pore complex, NPC. The pore is lined by a subset of NPC members called nucleoporins that present FG (Phe-Gly) receptors, characteristically GLFG and FXFG motifs, for shuttling RNAs and proteins. RNA cargo is bound to soluble transport proteins (nuclear export factors) such as Mex67 in yeasts, and TAP in metazoa, which pass along the pore by binding to successive FG receptors. Mtr2 when bound to Mex67 maximises this FG-binding. Mtr2 also acts independently of Mex67 in transporting the large ribosomal RNA subunit through the pore.
Statistics
?
PSSM-Id: 402175
View PSSM: pfam10429
Aligned: 6 rows
Threshold Bit Score: 196.596
Threshold Setting Gi: 74635515
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WWU_L  13 ANQAQI--------TATFTKKILAHLD------DPDSNKLAQFVQLF--------NPNNCRIIFNATPFAQA-----TVF 65  Saccharomyces cerevis...
Q6CWP0   2 NRQPQI--------VETFVKKVLAHLD------EPDPAKLEQFLQLF--------NPHQCKIIFNSQPFGQA-----VQF 54  Kluyveromyces lactis
Q6FWG2   8 NSQYHL--------IDIFVKKVLAHLD------EQDPNKLMNFLQLFqssknmppSPTVSKVVYNSMPFADP-----SIF 68  [Candida] glabrata
Q757C4   6 AGHSQA--------AETFVKKLLAHLD------ECDVDRLQQALPLF--------QPH-CRIVVNTQPFASP-----AAF 57  Eremothecium gossypii
Q6CF15  20 NGPTQQqvthtvtnTESFLRQFFKALD-----------DHRQNLPQF--------LRPDTAIVWNGTPIAGR-----DAF 75  Yarrowia lipolytica
Q6BMR4   2 SNIQRD--------PKPYLKKILSSLDiqyqgpSQQFPNVESYATQFgk-----qLKPQCAIIMNGKPLIPTnndakLEF 68  Debaryomyces hansenii
4WWU_L  66 LQMWQNQVVQTQHALTGVDYHAIP--GSGTLICNVNCKVRF-DESGRDKMGQDATVPIQpnnt-----gnrnRPNDMNKP 137 Saccharomyces cerevis...
Q6CWP0  55 LQAWQTGVVLTQHVITAVDFHVIP--GTGTLLCNVNCKVRF-DESGKDKNGQDSTVPANsqdsqsrpgqgsiNSRSLDKP 131 Kluyveromyces lactis
Q6FWG2  69 LTMWSQQVVQTQHIISALDFHVIPtgASNTIICNVNCKVRF-DESGRDKMGQDSVIPMGp-----------sGAKRMNNN 136 [Candida] glabrata
Q757C4  58 LQTWLQAVVATQHTLTSLDYHVIP--GTATLVCNAACKVRF-DESGRDKMGGDAVLPAP-------------AARAQPRA 121 Eremothecium gossypii
Q6CF15  76 LGIYAQMPATVTHDMFGFDCHGVN----GGTIINATGRVRMtNERGKDPHGFSFT-----------------GMVRPDET 134 Yarrowia lipolytica
Q6BMR4  69 QKKWLLSP-LTFHQLNSFDSHLIP--GTGTFVINASGKVKF-DESGRNRLGETSDLIHP-------------INNATVKG 131 Debaryomyces hansenii
4WWU_L 138 RPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDSLLKI 184 Saccharomyces cerevisiae S288C
Q6CWP0 132 RPIWGTYYGVSLQLVLEDRIFTNDLNGVISSMNYTIVFKPSDSLMSI 178 Kluyveromyces lactis
Q6FWG2 137 RPLWGSYFGVSLQLCLDDRIFRNDINGVITSLNYKIVYKPEDSLIKI 183 [Candida] glabrata
Q757C4 122 RR-WGTYYGLSLQLVLDERVLAGDAAAAIAALNYTLVFRPDDTLMSI 167 Eremothecium gossypii
Q6CF15 135 QPPSASQTSVPQYLV---------------SFSYRIVHRPEDSQVEY 166 Yarrowia lipolytica
Q6BMR4 132 RPVWGSWFGFNLNLIVDESILNNPESEAINSYNYRFTYKPDDSVIQI 178 Debaryomyces hansenii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap