1EP1


Conserved Protein Domain Family
DHODB_Fe-S_bind

?
pfam10418: DHODB_Fe-S_bind (This model is not part of the current CDD release)
Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B
Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases, DHODs, A and B. The B enzyme is a prototype for DHODs in Gram-positive bacteria that use NAD+ as the second substrate. DHODB is a hetero-tetramer composed of a central homodimer of PyrDB subunits resembling the DHODA structure and two PyrK subunits along with three different cofactors: FMN, FAD, and a [2Fe-2S] cluster. The [2Fe-2S] iron-sulfur cluster binds to this C-terminal domain of the PyrK subunit, which is at the interface between the flavin and NAD binding domains and contains three beta-strands. The four cysteine residues at the N-terminal part of this domain are the ones that bind, in pairs, to the iron-sulfur cluster. The conformation of the whole molecule means that the iron-sulfur cluster is localised in a well-ordered part of this domain close to the FAD binding site. The FAD and and NAD binding domains are FAD_binding_6, pfam00970 and NAD_binding_1, pfam00175.
Statistics
?
PSSM-Id: 519367
Aligned: 81 rows
Threshold Bit Score: 43.37
Created: 15-Feb-2025
Updated: 28-Apr-2025
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EP1_B        220 ESRMACGIGACYACVEHDKEDES-HALKVCEDGPVFLGKQL 259  Lactococcus lactis
Q6N0P0        878 nSIMVDATGMCGACMVPVTIDGKmVRKHACIDGPEIDAHII 918  Rhodopseudomonas palustris
Q728X7        214 NSIMVDGIGMCGACRVTV----GgETRFACVDGPEFDGHKV 250  Desulfovibrio vulgaris str. Hildenborough
Q831F0        211 NPIMIDGTGMCGGCRVTV----DgTMKFACVDGPEFKGNEV 247  Enterococcus faecalis
Q9X1X4        215 nPIMVDGTGMCGACRVTVSGQ----IKFACVDGPEFRGEEV 251  Thermotoga maritima MSB8
WP_011993470  215 NSIMIDGTGMCGGCRTLIKNEKDgEIKYVCVDGPEFDGRYV 255  Fervidobacterium nodosum
WP_011523597  213 NPVMIDGTGMCGGCRVTV----RgKVRFACVEGPEFDAHEV 249  Candidatus Korobacter versatilis
WP_003512659  212 NPVMIDGTGMCGGCRVTV----GgEIKFACVDGPDFDGHLV 248  Acetivibrio thermocellus
Q2ILN2        212 NAIMVDGTGMCGSCRVTV----GkDVKFACVDGPDFDGHQV 248  Anaeromyxobacter dehalogenans 2CP-C
Q8RC73        213 NPLMVDGTGMCGACRIEV----GgETKFVCMDGPIFDGHLV 249  Caldanaerobacter subterraneus subsp. tengcongensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap