1ZKE


Conserved Protein Domain Family
DUF2443

?
pfam10398: DUF2443 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF2443)
This is a small family of highly conserved proteins from bacteria, in particular Helicobacter species, The structure is a bundle of alpha helices. The function is not known.
Statistics
?
PSSM-Id: 371028
View PSSM: pfam10398
Aligned: 6 rows
Threshold Bit Score: 107.505
Threshold Setting Gi: 81665735
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZKE_F        3 MFEKIRKILADIEDSQNEIEMLLKLANLSLGDFIEIKRGSMDMPKGVNEAFFTQLSEEVERLKELINALNKIKKGLLVF 81  Helicobacter pylo...
Q7MSV7        1 MFEKIDLILRGIEASREEIEILLNMAKISFVDYIMIKRGSMDMPEHLGVWNLQQIDTEVAKLKEHIEALNKIKKEVLNW 79  Wolinella succino...
Q7VGZ6        1 MFEKIDEIFKNIEDIRDDINILLNIAKISLIDYIMIKRGSQDMPEHLTFTMLAQIDEQIEKLKAQIDALNKLKRELLIF 79  Helicobacter hepa...
EES90224      1 MFERIDSLLKKIEEAQAEIEFLLRLAKISFVDYVMIKRGSQDMPPSLDMWNLQQIDEEVSKLKEAIDSLNKIKKEVLTW 79  Helicobacter cana...
CBY83228      1 MFERLDQLIKDIENAKEEVELLLKLANVSLSDFILMKRGSLDIPEGLDMAFYTQISEHVEELKECINALNKYKREMLVF 79  Helicobacter feli...
WP_013890678  1 MFEKLELIIKNIENSKEEIEVLLKIANISLGDFILMKRGSLDIPDTLNMAFYTQIGEHVEELKEHINALNKYKREMLVF 79  Helicobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap