Conserved Protein Domain Family
ELL

?
pfam10390: ELL 
RNA polymerase II elongation factor ELL
ELL is a family of RNA polymerase II elongation factors. It is bound stably to elongation-associated factors 1 and 2, EAFs, and together these act as a strong regulator of transcription activity. by direct interaction with Pol II. ELL binds to pol II on its own but the affinity is greatly increased by the cooperation of EAF. Some members carry an Occludin domain pfam07303 just downstream. There is no S. cerevisiae member.
Statistics
?
PSSM-Id: 402145
View PSSM: pfam10390
Aligned: 31 rows
Threshold Bit Score: 271.853
Threshold Setting Gi: 47214209
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDX11139              16 STGNYGMSQSHRYTD-DSKEYIIVKLTDSAFRAIEEYQRddnaKRLQPGQRAKIQF-VGNTGVIHFPRPATDangipnan 93   Drosop...
XP_694180              6 QEHRYGLSCGKINKSiPNKTIFHVKLTDTAIRTLEAYQN----LKGSLPNQPAICF-KGNQGYIKIPASSDSpd------ 74   zebrafish
XP_005470820           6 QEHRYGLSCAKINKNtPNQTLYHVKLTDTAIRTLEAYQN----LKTSLSNQPAICF-KGSQGYIKIPAPTPEspd----- 75   Nile t...
XP_006629044           6 QEERYGLSCGKINKNiPNKTLYHVKLTDTAIRALEAYQN----FKASIPHQPVICF-KGSQGYIKIPVPSADssg----- 75   spotte...
XP_008187674          14 sNQNNGLMPKQRTGK--NKTLFFVKLTDSCLKAVEDYLRccqqGNSENLPKPRIQF-KGNEGQLCVPSISKN-------- 82   pea aphid
WGS:AAPU:GI13662-PB   17 sSGNYGMSQSHRYTD-DTKEYIFLKLTDSAYRAIEEYQRnenaKRLAPGQCAKIQC-NGNTGFIHFPLPSSDssnsvnng 94   Drosop...
KPU78916              16 STGNYGMSQRHRYTD-DSKEYIIVKLTDSAFRAIEEYQRddhaKRLPPGQRAKIQF-TGNEGVIQFPRSSSDanghhnnp 93   Drosop...
XP_318017              5 CAGSYGLSQQGSLND-ENKELIFVKLTDSALRAIEEFQRt--qAKLGTSHNPSIQFlQNGQGFLSFPSGGNNv------- 74   Anophe...
CAG00837                 --------------------------------------------------------------------------------      spotte...
XP_005989805           6 EAGHFSLSYSKVSQV-SRKTFYHVKLTDSALRTLQAFRN----LKISLPKQSLISF-RGNRGYIKIPDDNYPng------ 73   coelac...
EDX11139              94 gng-----sdatgaggggsRKFGFTINNME------GTLECVQQ-----QQRNLGVLGAVTLRMRIHANDDVYDSTRTKM 157  Drosop...
XP_694180             75 -----------------afRVFSFYLSSDSkdk-pqASFDCVHQfvsgdGRDRLEGQGSIQDKITVCATDDSYQMTRERM 136  zebrafish
XP_005470820          76 -----------------gfRVFSFYLSSDSkdk-pqSSFDCIHQyvsgeGRDHLEGQGSIQDKITVCATDDSYQTTRERM 137  Nile t...
XP_006629044          76 -----------------alRVFSFYLSSDSkdk-pqASFDCIHQyvssdGREQLECQGSIQDKITVCATDDSYQMTRERV 137  spotte...
XP_008187674          83 -------------------YTFDFSLSNTTdaaaprSSFECIRQn----TSRSLEYVGTLNRHIRVLANDDVYEATRHRM 139  pea aphid
WGS:AAPU:GI13662-PB   95 -----------sgsgmeagRKFGFTIDDLE------GTLECIQQ-----QQQELDVLGALARRMRIHANDDVYDTTRSKM 152  Drosop...
KPU78916              94 stngngngngngnsgndpgRKFLFTINNME------GTLECVQQ-----QQQNLGVLGAVTFRMRIHANDDVYDTTRTKM 162  Drosop...
XP_318017             75 -------------------QKFNFSITDIDt-----GSIECIQQ-----AQGQLQNMGHIPHKMRIHANDDVYETTRHRL 125  Anophe...
CAG00837               1 -----------------------------------------------sdGREQLEGQGVIQDKITVCATDDSYKMTRERM 33   spotte...
XP_005989805          74 ------------------lRVFSFDVSNDSkdk-phSGFDCIRQns-cgGQCQLGFLGSIQDKITICATDDSYQATRDRV 133  coelac...
EDX11139             158 AIAEETEKSKCIREIKPN-QSDIGRKV---KKPPttiqssastasafsssnssnsgltttafhhhsncnnsgnnnnsiss 233  Drosop...
XP_694180            137 SQVEKDIWSRSAIEIKPG-STRPSKCVk-iKKKQ---------------------------------------------- 168  zebrafish
XP_005470820         138 SQVEKDIWSRSAIEIKPG----PSKCVkvqRKQG---------------------------------------------- 167  Nile t...
XP_006629044         138 SQVEKETWSRAAIEIKPG-TTHPSKCVkiqKKHG---------------------------------------------- 170  spotte...
XP_008187674         140 VAVEELHKKSCTREIELDsKSALSRKIr--KNPAqiranrhn-------------------------------------- 179  pea aphid
WGS:AAPU:GI13662-PB  153 ARVEETEKSKCIREIKPN-QSDIGRKV---KKPAsasshhsgnnnsnnnssnsnsfns---------------------- 206  Drosop...
KPU78916             163 AIAEETEKSKCIREIKPN-QSDIGRKV---KKPPsmmsssnnnnnnnnassfssfnsssansgsmttttafhhhnnnnnn 238  Drosop...
XP_318017            126 AAAEENQKNKCTREIKPN-QTDIGRKVk-lKNPAirnipsnntavvnkrdsiysnnsvnktssvaasqlssnnsvnsynn 203  Anophe...
CAG00837              34 SRVKKDNWSRSVIEIKPG-ATHQIKGVkfhKRLA---------------------------------------------- 66   spotte...
XP_005989805         134 TQVEKESWSRTAIEIKPG-ATYRSKGVnvaKKPG---------------------------------------------- 166  coelac...
EDX11139             234 fnsfnsn-----------------------------------------nhsrklgsspfnglgvgssssssafasrspnp 272  Drosop...
XP_694180                --------------------------------------------------------------------------------      zebrafish
XP_005470820             --------------------------------------------------------------------------------      Nile t...
XP_006629044             --------------------------------------------------------------------------------      spotte...
XP_008187674             --------------------------------------------------------------------------------      pea aphid
WGS:AAPU:GI13662-PB  207 ------------------------------------------------------------------------------nn 208  Drosop...
KPU78916             239 sginnnnnsssnsfnnnnnnnnhsrklasspfnglgvgmgggsnsatnsasssinsssaaaaayssrspnpsmlgasgtv 318  Drosop...
XP_318017            204 lats-----------------------------------------------pklaktnglhqssqqqlqsqqqlqqqplq 236  Anophe...
CAG00837                 --------------------------------------------------------------------------------      spotte...
XP_005989805             --------------------------------------------------------------------------------      coelac...
EDX11139             273 stlgasgtvngsgvgggryggGAASSLAStfangisqgynNLSGSSPRDSmtagtsgatassaiss-------------- 338  Drosop...
XP_694180            169 ----------------------SLSASFD-----------STNKHSPSN------------------------------- 184  zebrafish
XP_005470820         168 ---------------------LVSSSD-------------SNNKHSPNN------------------------------- 182  Nile t...
XP_006629044         171 ---------------------APMPGDSF-----------PSHKHSPTG------------------------------- 187  spotte...
XP_008187674         180 ---------------------------------nnsynnvNITNNVPKPIiskpip------------------------ 202  pea aphid
WGS:AAPU:GI13662-PB  209 srklvsspfngltsssvataaTAVAAAAT-----------SIASRSPNPNilgasgtvngsrstalantfangisqgyal 277  Drosop...
KPU78916             319 ngttgggggryhhqyhggagaGAASSLAStfasg-isqgyNMSGSSPRDSaqgqmsggangr------------------ 379  Drosop...
XP_318017            237 qqpqsqhllqqnnhqsqpptqLPPVQAKPgyqhtvhdppnSQQQHVPKLSengnsqs----------------------- 293  Anophe...
CAG00837              67 ---------------------PLCASEN------------SFQRQSASN------------------------------- 82   spotte...
XP_005989805         167 ---------------------LCSISKGL-----------NFRKSSPASP------------------------------ 184  coelac...
EDX11139             339 ---------------------rnkmpsggltssnsnsSSSSRSannk--------ssgGNKMSDVSRRNIRERLIHLLAL 389  Drosop...
XP_694180            185 -----------------------------------------KR---------------NGGPSLVTHRPLRERVIHILAL 208  zebrafish
XP_005470820         183 -----------------------------------------KR---------------SLVPSPVAHRPLRDRIIHLLAL 206  Nile t...
XP_006629044         188 --------------------------------------AGPKR---------------SSAPSPVAHRPLRDRIIHLLAL 214  spotte...
XP_008187674         203 ----------------------------------------------------phiplpTNHASDISKKPLRDRIIHLLAL 230  pea aphid
WGS:AAPU:GI13662-PB  278 sgssprdsnsttagtvagtalggsfnsngrnkmlngsGSNSRSgntksggangngggnGNKMSDVSRRSIRERLIHLLAL 357  Drosop...
KPU78916             380 --------------------------srmasgggnatGASSRSannk--------ssgGNKMSEVSRRNIRERLVHLLAL 425  Drosop...
XP_318017            294 ---------------------------------------------------rvangrpKAANPDYMKCNIKERLIHMLAL 322  Anophe...
CAG00837              83 -----------------------------------------RR---------------NSCIATATHKPFRERIIHLLAL 106  spotte...
XP_005989805         185 -------------------------------------TQMPKK---------------AAATSTLTHRALRERLIHLLAL 212  coelac...
EDX11139             390 KAFKKPELFARLKNEGIRDRERNQITNILMDISTM--SHNTYNLRRQMWNDVDENWPFFSEQEVQQLKRRKPQNL 462  Drosophila ...
XP_694180            209 KPYSKPELLLWLEREKASPKDKADLSPVLDEVAKLnpKEHSFTLKDDFYRHVRKDWPGYVEEERQLIQRVLARKL 283  zebrafish
XP_005470820         207 KPYRKPELLLWLDRERATPKDKADLTSVLEEVAKLspKDHSYSLKDELYRHVQRDWPGYLEEEKQLIHRLLIRKL 281  Nile tilapia
XP_006629044         215 KPYRKPELILWLERDRASPKDKADLGSVLDEVAKLnpKNHSFTLKDEFYRHVHRDWPGYTEDERQHIHRLLARKL 289  spotted gar
XP_008187674         231 RPYKKPELISILNRDGLKDKDRTQIMSVLSHVAQA--KDNAYYLLRHIWNEVQEDWPFYSSQDHIVLKRRKPQNL 303  pea aphid
WGS:AAPU:GI13662-PB  358 KPFKKPELYARLKNEGIKDRERNLIGNILTDISTM--SHNTFNLRRQMWNDVDENWPFFSEQELQQLKRRKPQNL 430  Drosophila ...
KPU78916             426 KAFKKPELFARLKNEGIRDRERNQITNILMDISTM--SHNTYNLRRQMWNDVDENWPFFSEQELQQLKRRKPQNL 498  Drosophila ...
XP_318017            323 KPYKRPELVVKLQQDGVRKEEMKCTQQILKTISST--RDGVLILHRNIWNEVQDDWPFYSEQDRQAVKRRRPQNL 395  Anopheles g...
CAG00837             107 KAYRKPELLLWMEQEKASPRDKAELGGILEEVAKVnpKDGSYVLQDHFYRLVQKDWPNYSEEERRLIGRLLA--- 178  spotted gre...
XP_005989805         213 KPFRKPELILWLEREGAHPRDKTELPSLLDEVAKLnpKENSYSLKEELYRLVQTDWPGYSKEDRQLLHRLLLRkq 287  coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap