Conserved Protein Domain Family
GRAB

?
pfam10375: GRAB 
GRIP-related Arf-binding domain
The GRAB (GRIP-related Arf-binding) domain is towards the C-terminus of Rud3 type proteins. This domain is related to the GRIP domain, but the conserved tyrosine residue found at position 4 in all GRIP domains is replaced by a leucine residue. The Arf small GTPase is localized to the cis-Golgi where it recruits proteins via their GRAB domain, as part of the transport of cargo from the endoplasmic reticulum to the plasma membrane.
Statistics
?
PSSM-Id: 402134
View PSSM: pfam10375
Aligned: 24 rows
Threshold Bit Score: 77.6438
Threshold Setting Gi: 1064993592
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ODQ63571      413 SDGGVVDKQIITNLFLSFLDIPRGDTKKFEVLQLISNFLGWDEEQKAQA 461  Nadsonia fulvescens var. elongata DSM 6958
ONH68025      442 SDAETVDKELVTNLFISFLTIPRGDTKKFEVLQLISNYLNWDEDKKIQA 490  Cyberlindnera fabianii
ODV82844      323 STSELVDRELISNLFISFLQLPRFDSKKFEVLKLISNFLNWDDDKKQHA 371  [Candida] arabinofermentans NRRL YB-2248
ODV59613      413 NENSSVDKELISNLILKFLSIQRGDAKKFEVLKLISSYLNWDKNQQIQA 461  Ascoidea rubescens DSM 1968
SGZ52077      483 NTDNTVDRELISNVFLNFLQIPRGDSKKFEALLLISALLDWDEPRKVQA 531  [Candida] intermedia
XP_004198418  391 NSNNTIDKDLVSNLILSFLQFPRGDTKKYEALQLISALLEWDESQKVSA 439  Pichia farinosa CBS 7064
EGV60116      135 SVDNTIDKELISNVLINFLQIPRGDTKKYEALQLLSSLLEWDESKRVAS 183  Yamadazyma tenuis ATCC 10573
GAO49033     1144 SSNSTVDRQLVTNLVLKFLSLPRGDARKFEALGVLGGFLGWTEEERGVA 1192 Saitoella complicata NRRL Y-17804
XP_002175621  352 ENAEKVDKQLISNLLVSFLSLPRADTKRFEILQLIASVLEWNDEQREQV 400  Schizosaccharomyces japonicus yFS275
RIB24627      292 SSENNVDKRLITNLLIAFFNTPRGDSKRFEILQLMANMLQWTEEQKEQV 340  Gigaspora rosea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap