Conserved Protein Domain Family
DUF2434

?
pfam10361: DUF2434 
Protein of unknown function (DUF2434)
This is a family of proteins conserved in fungi. The function is not known.
Statistics
?
PSSM-Id: 402123
View PSSM: pfam10361
Aligned: 41 rows
Threshold Bit Score: 293.002
Threshold Setting Gi: 213408204
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKG10763             41 YDNGTISNSSRCYLIFDQYQPIM----MSNGSWINGTSCYFPYYSIHTRGAIGIAFAALFGASIMFTLINLRKHGRLFLR 116 Macropho...
CAZ79642             30 YSNGTLSNSSRCYLVFDTYRPWI----ASNGSVFNGTKCDSPINPIATRGALGITFAVLYAVVIVFVCVHLRKHGATHLP 105 Perigord...
CCX15942             30 YGNGTLSNDTNCFLVFDVFNVFF----LPNGTSINGTSCSIPIHNIATRGGLGIAFGAIFAILIILATTCLAKHGAVHLP 105 Pyronema...
Q6C6A3               31 IENGTLTNGPQCWLSFGDHIPTFvhieYLDTYAINGTTCDSPYYSMGNKGYLGVMLSVGIAAATLVTFFNLRKHGMNFMH 110 Yarrowia...
CCG80590             27 YFNGTISNATQCYMLRVPYLPQI----FPNGTIVNGTGCSTPINAIASHGISGIVFACMFVLMIPLCVYSLNRHGRRAYT 102 Taphrina...
XP_002174873         17 YANDTLSNDTYCCVYNDEYVPTI----DDDGTLV-GVHCDSPILPIGPHGRTGVLISVICFVLVAFILPNMIKHG-WACP 90  Schizosa...
EPY50833             17 YGNGTVGNGTHCYLWRQHNWPSI----TEEGTVLDGVNCDSPVKKLAGHGAVGIVSACLGFLLIPFLLMNI---GKFNVP 89  Schizosa...
WGS:ABKI:PADG_08131  42 YSNGTLSNGSNCWLLFDIYKPRM----LSNGTFLNATSCYSPIGDLEKRGSVGIAFASMFAVTIVFTLINLKKHGMMFLP 117 Paracocc...
XP_001539966         42 YSNGTLSNGSNCWLSFDMYQPSI----LSNGTFINATSCYFPINGLEARGSVGIAFASMFGATIVFTLINLRKHGKTFLP 117 Histopla...
XP_002847915         41 YSNGTLSNGSSCWLTFDIYKPYL----LSNGTFINGTSCYVPIKGLKTRGSVGIAFAALFAATLLSAIINLRKHGERLLP 116 Microspo...
EKG10763            117 EDKRFRVI------------------GRRWQWYWMCFVAACGMISTITSVDVDRNYLQSLPIILQSFFFTLMLPGTLAMV 178 Macropho...
CAZ79642            106 LEKRFRLV------------------SRRWQWYWLMITCACGMMSGFTAIDIDRDYLMGTPFILSVLFYWVMVPTTLAAV 167 Perigord...
CCX15942            106 LSKSFRPV------------------SRRWPWYWLLVAGTCGCISGMVAIDIDRDYLQGTALILQNIFYYVLLPATLASV 167 Pyronema...
Q6C6A3              111 EPKAEELMsqggrpsktktaepgwirGRRLPWFLLLVLGLMLILTGFFAVDIDRNYIQGTAAGMYGVFLSVCPVLGLMVS 190 Yarrowia...
CCG80590            103 AKNRVYPY------------------GKRWEFYWQLITIVFILISSFCSIDIDRVVIQGGSTGAYDLFWAASLPTCQASI 164 Taphrina...
XP_002174873         91 HNPCTARC------------------RRRAEWIFLTFMLFLLAFAGLDWIEIDRAILPGNYVALLGFLFQAGTCACLASL 152 Schizosa...
EPY50833             90 GAQKGF--------------------QRRAEFYWMILLILVLAVSGFAYIDVDRNPVQGLSMCIFSFCFHSNVPILVLVY 149 Schizosa...
WGS:ABKI:PADG_08131 118 SEKRWGAI------------------GRRWQWYWMLFVAACGIISCFMSIDVDRVYLQGIALSLQSFFYYLLLPGLLAAV 179 Paracocc...
XP_001539966        118 LEKRWRAV------------------GRRWQWYWMLFVAACGMISCFMSIDVDRSYLQGIALSLQSLFYYLLLPGLLAAV 179 Histopla...
XP_002847915        117 IEKRWTIV------------------GRRSQWYWMIFLAICGVVSCFMSIDVDRDYLPQSAIVLQSFFYYLMIPVMLAVV 178 Microspo...
EKG10763            179 WEAVRHWGSWQERQI----CDRDPFLLPQDDRR---GKTEFYLPLVFYLFAWLSFFMEIPRSWTRIQFQRSPWQQSHYAE 251 Macropho...
CAZ79642            168 WETTRHWGSFLERQI----MESSPFKLSQEDRR---SKIEFYVPLVFYLFAFLTFFLSILRSWNPIRKG---------FK 231 Perigord...
CCX15942            168 WEMTRHWGSLCERIL----LDEDPWRFPHEGPR---DKAEFYLPLVFYLFGFMTFFLSVLRTWTMVSKG-TWSPDVSAAI 239 Pyronema...
Q6C6A3              191 WEFIRRWGFFEERKL----LEQDPYAIDQTDLK---SKARIIPPIVFYVSCFFAMFMMVLRNWS---------KHLDYNT 254 Yarrowia...
CCG80590            165 WELSRNWGQIESDKFrtrhIE---MSLEQHERRv-tTTFQFWMPILFYVMDFLALFLTSFRPWTAVYQGNMY-------- 232 Taphrina...
XP_002174873        153 WHFVSSYGYGRRVYL----LAQNQTIEKLDSRDhwiYGFEFYVPVLFYILLLITFFLDALRPWAAITEGNLD-------- 220 Schizosa...
EPY50833            150 WHYVSTFGFIRWREL----TVVGREADGSERRKr-iETMEYGMPIVMYILSMLGFLLAGFHSWARIARGEAA-------- 216 Schizosa...
WGS:ABKI:PADG_08131 180 WEGVRHWGSWQERQI----CDRDIFAFLTASTR---ETQEFYLPLIFYLFAWLNFFMVIPRSWVTIQKQHSYDLTMTTAK 252 Paracocc...
XP_001539966        180 WEGVRHWGSWQERQI----CDRDTFAFSEASTR---ETQEFYLPLIFYFFAWLNFFLVIPRNWNSIQKQGNQDQTMSIAK 252 Histopla...
XP_002847915        179 WEAVRHWGSWQERQI----VDRDNFAFPAATTR---ERQELYMPLVFYLFAFLSFFLYIPRSWSAIEKQRTFDQQEAVAR 251 Microspo...
EKG10763            252 PAATDARFKAGAIFSVIAWIVIIVSLHHSLHHYrpKPASGGVMARINSFCIHCPTKLFLALVVLAIRLAYA--VASAWVW 329 Macropho...
CAZ79642            232 SAITDPRFRTSAVFSLIALLVIVFSFCVSIHYY--KPLSH-----------RIPAKIPICITLAFVRVAYA--IACSWEA 296 Perigord...
CCX15942            240 AASTDGRFKASSIMAFIAWCVIWGSVFTSVKYY--QPVSR-----------HVPWKIPISMTFLLIRIIYN--IGVAWEY 304 Pyronema...
Q6C6A3              255 FFDLDVRWVIGGICEVFAFIQLVNSLRVTITYY---------------QVPQVPLVLPFMVFMNLLTEIYQvtVMVVNDK 319 Yarrowia...
CCG80590            233 -AATDGRFKAGALFSVFAYLVNLWIIVNAIYAY--KPDLRQFHFYTVALC-------MTSVLVRVIYTNYS--MYLPNGW 300 Taphrina...
XP_002174873        221 -VVVDSRAKVACVFLTLCWLAILGQFLVYRKFYgnCPRQR-------------DTAILFLLLCFIPRIIFQ--FVGAWNA 284 Schizosa...
EPY50833            217 -VATDARFKASAVINLFGLGCCVGAFCVYLKEYgrDRRKR-------------WMSVYMGGLMVLLRGVYG--CISSWKY 280 Schizosa...
WGS:ABKI:PADG_08131 253 PSATDSRFKAGSIIAAVCLVIICYSLGHSIYRY--KERPTNRLRSMTYYISSAPPKFIICILLIGIRVGFG--IASAFSW 328 Paracocc...
XP_001539966        253 PSATDGRFKAGSIIAVVCLAVICYSLWHSVYRYkqQPVKP-LFRSITFYLSSAPLKYCICIILTGLRVGFG--VASSFSW 329 Histopla...
XP_002847915        252 PAATDARFKAGSIIGGICIFIICYSLGHSLYRYkwQAQAR---PSLVFLVTSAPLKFIIVITLASVSIAFN--VASSFIW 326 Microspo...
EKG10763            330 DISLLKY 336 Macrophomina phaseolina MS6
CAZ79642            297 DINPLSI 303 Perigord truffle
CCX15942            305 DIGPLrp 311 Pyronema omphalodes CBS 100304
Q6C6A3              320 TVSPFYP 326 Yarrowia lipolytica
CCG80590            301 TISAFNP 307 Taphrina deformans PYCC 5710
XP_002174873        285 QLHLYNE 291 Schizosaccharomyces japonicus yFS275
EPY50833            281 NWNASNP 287 Schizosaccharomyces cryophilus OY26
WGS:ABKI:PADG_08131 329 DISPIRY 335 Paracoccidioides brasiliensis Pb18
XP_001539966        330 DISPAKY 336 Histoplasma capsulatum NAm1
XP_002847915        327 MISPLKY 333 Microsporum canis CBS 113480
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap