Conserved Protein Domain Family
Fmp27_WPPW

?
pfam10359: Fmp27_WPPW 
RNA pol II promoter Fmp27 protein domain
Fmp27_WPPW is a conserved domain of a family of proteins involved in RNA polymerase II transcription initiation. It contains characteristic HQR and WPPW sequence motifs. and is towards the C-terminal in members which contain Fmp27_SW pfam10305.
Statistics
?
PSSM-Id: 402121
View PSSM: pfam10359
Aligned: 94 rows
Threshold Bit Score: 350.399
Threshold Setting Gi: 511008644
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT01229     1746 GIKVRFDSFMLDMHQRREEFNTRDKGRKMKSRTTGMKIHACQLDLASADIRAVSASIRGTTAESI-QNSLshyihneeen 1824 Sporothrix sc...
CCH61833     1714 GVKAKVSQFVMDLHQRKELIPSFNKELGIKKNILKMKFFEGDISLQTIDVRALFGHFKEPDFRKVqPKGH---------- 1783 Tetrapisispor...
Q6FSI2       1718 GIKAKAGRFLMDLHQRKEVFTEYQEELDRIKKVQKLKFLDGLVATFDIDIRAVHGLFTKLEYTEQrEDAK---------- 1787 [Candida] gla...
CCD24333     1705 GLKAKASHFKMDLHQRKELVTEYQEMLDVTKRVKKLKFLEADIIVNNIDVRTLHGMFRKLNYIEEkEDAE---------- 1774 Naumovozyma d...
CCC71333     1711 GLKAKVGQFVMDLHQRKEVVTEYKKKLNVTKRVKKLKFLSADILTHRIDIRTVHGIFHKLNFIEEkAHAK---------- 1780 Naumovozyma c...
CCK70267     1678 GTKTKTKRFTMDLHQRKELVTEYNPELDIRKRVKKMKFLEGEVEMDDIDIRTIHGKFGKLAYVEQkEDAH---------- 1747 Kazachstania ...
XP_003954883 1675 GVKGRAAHFILDLHQRKEVLTAYNKEMNVRKKVQKLKFLEGDVILHGIDIRVIRGELERLKYVEQkEDAR---------- 1744 Kazachstania ...
CCE93911     1665 GLKAKTEHFVMDLHQRKEVMLKYQEGLDKTKKIMNLKFLEGDVSTAAIDIRAVEATFKSAKFVEEkEDSN---------- 1734 Torulaspora d...
CDF87210     1682 GVKAKATKFVMDLHQRKEVLITYQEELNRTKQIMKLNFLAGEVWTKKFDIRTVEGSFKPMTSQHDkKDAF---------- 1751 Zygosaccharom...
XP_002496498 1700 GVKAKATKFVMDLHQRKEVLITFQEELNRTKQIMKLNFVGGEVLAEKLDIRTVQGKFKPMKTPEDkNSGV---------- 1769 Zygosaccharom...
ERT01229     1825 adisrFTIPDDDFSWIDMDDFVELDWILPTEPNPDTKIFPLAFAPRITYFRQTDIGGVISGDPD---RTSPFGHESTHFC 1901 Sporothrix sc...
CCH61833     1784 -----FDIFDNDMSWYDRSDFKEAFFIEFDKYIPNISMRPLAFSPHFLYQKRASYGDIYQLHPKtlePIVPFNTHISYGC 1858 Tetrapisispor...
Q6FSI2       1788 -----YDIHDNDMQWIDLTDFQEAFYVEIDNFLPNIKILPMLSAHKFIYSKHASYGDKYQVDPKtynPIKPFDNSISHDC 1862 [Candida] gla...
CCD24333     1775 -----YHIFDNDMRWLDIMDFQEAFFVDVNNYFPVIEINPMLYAPGFMYKKRASYGDKYQVDAKdykPIKPFENKVSHNC 1849 Naumovozyma d...
CCC71333     1781 -----YDIFDNDMSWLDISDFQEAFYIDVSNYVPNVDIRPLLFAPEFVYKKRANYGDKYQLNPKtyeRIEPFNNGVSHDC 1855 Naumovozyma c...
CCK70267     1748 -----YDIFDNDLTWLDLTDFQEPFFVDVDKYLPSVEIKPFFHAPNFIYQKRSSYGDKFQLDPVtyqPTTPFLNNVSHNC 1822 Kazachstania ...
XP_003954883 1745 -----YKIFDNDMAWLDLTDFKEAFFIDPELYLPNIEIKPFAYAPRFIYQKRASYGDKFQVNPNtyePIKPFRNDISHAC 1819 Kazachstania ...
CCE93911     1735 -----IQIPDNDLAWYDPTDFEDTDFIDIDSYVPNLRMLRLLYSCQFKYRRRASYGDKFQVDPNthkRIVPFKNNISHKC 1809 Torulaspora d...
CDF87210     1752 -----FEVYDNDMAWYDVSDFNEAYSVDLENCVPKVRIQPLLYTPHFVYRKHASYGDKYQVDPKdhqPIPPFENGISHDC 1826 Zygosaccharom...
XP_002496498 1770 -----FEVFDNDMAWYDVTDFKEAYALGLENYIPHVRIKPFLYTPHFVYRKRASYGDRYQVDPKdhhSIPPFRNDVSHDC 1844 Zygosaccharom...
ERT01229     1902 IMTPDDdprTVQMHLVRARLRQLEDQIE----NHVRDINEAVKRINNennasiaNEIETLSRQANVLQEKKSFLENSLRL 1977 Sporothrix sc...
CCH61833     1859 ILGNHR---HTAKNVVDKRYEYLLKSKE----NLKKSLKAGSTSYTH-----------NKNKLMHDTNAAVKNIKKLKDD 1920 Tetrapisispor...
Q6FSI2       1863 AIRKPF---TPNFEVIRDRLERLKHVKA----TIESNHYGMDSESEQ----------KAHEKYLVRSEASVRNVQSLLED 1925 [Candida] gla...
CCD24333     1850 ILGSPV---EIHPEVFQKRLDVLKAFEM----KTTQELNVVEDPEKK----------KKLEKLVRDTRSTIKDVQTLLVD 1912 Naumovozyma d...
CCC71333     1856 IMGEHI---EIPPSLIEKRLEVLEEFEL----KIKAKLRKSIDPTEK----------AKLTTFLNMTAQAKESVELLLAD 1918 Naumovozyma c...
CCK70267     1823 VLGREV---QVPTKVLEDRLKNLTSFQT----QLTNDYLKTEDPSKK----------KLLNYLLEKAKVGLDSLDLLHDD 1885 Kazachstania ...
XP_003954883 1820 VLGQRV---DIPSETLDNRISQLSEFRStwetRLDEELMKPSNEQNK-------LKIKDYETLVHKAKVSLESVDLLLDD 1889 Kazachstania ...
CCE93911     1810 VFGEPL---KLPFKALRERKERLIEYKD----KLEQKLSGNDDESDV----------TFIKRHIKKTNTAIEKVELLLKD 1872 Torulaspora d...
CDF87210     1827 SLGKAK---LLQLGILEERVQLLKDLKA-------KSINGEDSNLHH----------GNQQELLAKLSLGIEKAQHLLED 1886 Zygosaccharom...
XP_002496498 1845 TLGHAE---HLQLGILKQRVHTLKDLRT-------KKAQENGDASHK--------------DFMQKLDLEIEKAQNLFED 1900 Zygosaccharom...
ERT01229     1978 LAEETAaastaraaaaasakaateareakrrereksgsvgpspsnengpSDASAAAN--AAASadgdkvgADSGAEFASE 2055 Sporothrix sc...
CCH61833     1921 LLTLQkqr---------------------------------------tnPDEELEYNfkSIGS-------IHSVTSSISK 1954 Tetrapisispor...
Q6FSI2       1926 LEIMTglk---------------------------------------ekIDSSKAYNypAIQL---------IQDTNSES 1957 [Candida] gla...
CCD24333     1913 FNSVCPktg--------------------------------------rvLTSSGKLKysALQL-------LHDSKMCNEA 1947 Naumovozyma d...
CCC71333     1919 FNSVCPktg--------------------------------------kiLTESGCFRypSLQL-------LHNSKLRNKS 1953 Naumovozyma c...
CCK70267     1886 VSALCYers--------------------------------------esTNDRRVYSipGVQI-------LDRSTVSTKE 1920 Kazachstania ...
XP_003954883 1890 LSALCYerd--------------------------------------vsTSAQRTYTmpTVQL-------LDRSSVTKKS 1924 Kazachstania ...
CCE93911     1873 FETLKrkq---------------------------------------dcENFEPSFNypMINM-------VQNSVIAANE 1906 Torulaspora d...
CDF87210     1887 FRYMHdhe---------------------------------------ngPAGSHNFYyeLPNL---------MRESMAQV 1918 Zygosaccharom...
XP_002496498 1901 FEHMQnhk---------------------------------------gdSADSHEYHyeLPNL---------MKRFLSES 1932 Zygosaccharom...
ERT01229     2056 FTNRFVVHNIKLKWNNMLRNIILRYIHQVSQRRGFVYYLSRPAVKFIIDIVEEQVKLKAGATPNTgdsssvatgatgtsp 2135 Sporothrix sc...
CCH61833     1955 FQNRYFIFNILLKWNEEVRDIVYKYLLFFTLRRNFYSLGSYKSLKIFDDMIKQFTQT--SEISKKysa----------sd 2022 Tetrapisispor...
Q6FSI2       1958 FDNKYYVYHMLLKWNEGVRDIAFKFLHFSNLTHQFMELASHKTNRMFNDIINKRQQKDNVNEEEDiss----------ki 2027 [Candida] gla...
CCD24333     1948 FENRYFIFGMLLQWNESVRDVVFKFWYYFSLSKDFNILSAQHSLEIFENIIKERISSEGKPNSPLddnt---------sa 2018 Naumovozyma d...
CCC71333     1954 FENRFLVFNMLLKWNEKVRDVVLRYLHFFNLTSDFHKLTSQHALETFDNILKQRLSQNQKSELEShge----------pi 2023 Naumovozyma c...
CCK70267     1921 FENRFFIFNMLLKWNEDIRDIIMKFLHYLSLASKFSSLSSQKSLKIFEEMMKHRIMNEKKMDMETineeqe-----pidl 1995 Kazachstania ...
XP_003954883 1925 FENRYFIINMLLKWNESVRDVIFRYMYLLTLSNEFASLASQKTLHVFEDMLQHKTSSEWKPGMQPakekpi-----ekkt 1999 Kazachstania ...
CCE93911     1907 YENRYHVCEMLLKWNEGTRNAVFKYLHYLSLSRQLSSLSEQQCSKLIDEIIRRKNAPGDTDRNSIdsq-----------n 1975 Torulaspora d...
CDF87210     1919 YENRYCINYMLLKWNEDTRDAMYKFLYFLGLADQFSALSASKSLQIIEDVVRQKTDYDQMRSRQEddr----------vp 1988 Zygosaccharom...
XP_002496498 1933 YEHRYCVNYALLRWNEDTRDALFKFLHYISLAHQFSQLSATKSLQIIEDVVKQKTESVLTEENHHhgs----------np 2002 Zygosaccharom...
ERT01229     2136 gAQQSADGAYNGDQts--gKDIEDRIRK----ILQDGrkfvsteefandcggknegtvyctpmeelsggiatEFTPQNNY 2209 Sporothrix sc...
CCH61833     2023 kEKSSSDILYERTSppemnEALKKIFEEgiydFFDTD-----------------------------------SFAIHENS 2067 Tetrapisispor...
Q6FSI2       2028 qRVKSEVEFDNANDdehvkAALLEMFEEglsqLGIDI-----------------------------------NHSISRNH 2072 [Candida] gla...
CCD24333     2019 sRIKSHFQFEDTNDqsvltAELLEMFERglseLSCSF-----------------------------------DFNKKENH 2063 Naumovozyma d...
CCC71333     2024 eRLNSKEQFRNAEDqsainNALVELFETalssLQCSI-----------------------------------KSVRHENH 2068 Naumovozyma c...
CCK70267     1996 qMGSGNKFGNKTDDlmhlsEICLDLFENgittVEADI-----------------------------------EYLVHKNT 2040 Kazachstania ...
XP_003954883 2000 fKNNFNDYPNKTPDi----KTIFEMFENelleLPVTL-----------------------------------DHIIHKNN 2040 Kazachstania ...
CCE93911     1976 rDGSQFEAELNRSNeenfnEVLEKIFKEgiseLGVDI-----------------------------------DYEVHHNH 2020 Torulaspora d...
CDF87210     1989 hEKRTVEIDLSNLKdnelnQSLSKILEKhlteLNISV-----------------------------------KNVSRSNH 2033 Zygosaccharom...
XP_002496498 2003 tKKPTKDIDWDALDgsninYMLSSILEKhmseLEVPV-----------------------------------KHILRNNH 2047 Zygosaccharom...
ERT01229     2210 HVHLIAPQIQLQSDKNKKHVVLVTAKGMELKVVEVMDKARLSDNVSGLVQRRFLVGMDSTQFFVTHRKWFS-T---RILS 2285 Sporothrix sc...
CCH61833     2068 VIQFIAPQIQLMTKTLNNACVLISAPVTEIKKVGFEEGQRNYLSKEGVVLNRSAIYLEKVNVFLFHQDTNE-D---YFEL 2143 Tetrapisispor...
Q6FSI2       2073 FVNFICPQIQLISDDDPNICVLVSTPIILLKVLSFDEETPDNVYLENTFLKRYGLFLSNANAFIFHKERFD-K---YPEL 2148 [Candida] gla...
CCD24333     2064 YVQFITPQVQLLTKEEPDSCIIVSTPNILLKVHAFEEAGHEAINMNNSFLKRTGVFFTNANAFLFHKDVFK-N---RFAL 2139 Naumovozyma d...
CCC71333     2069 YVQFITPQVQLMTKEENDSCVIISAPNVMMKVLAFEDERTEEINIDNDFLKRYGIIVTNANAFLFHKGDFK-D---NFEL 2144 Naumovozyma c...
CCK70267     2041 FLQLVAPQVQLSMREEPDMCVIVTAPNIITKNLSF--EQVGMEDHDDQFLKRFGVIVNNANAFLLRKADFK-N---KYEL 2114 Kazachstania ...
XP_003954883 2041 FIQFIIPQIQLTTEDDPDSCVIVTAPNVISQMISFEPKLFENIYYQDRFMKRNGLIANNANAFIFNKQNFK-N---KYEL 2116 Kazachstania ...
CCE93911     2021 IVHFISPQIQLITEQEPDSCVVVAAPSIMMKVMSF--GNKEAQYSDEAFLKRYAVHFIKGNVFHFRKDEYHvDregFHEV 2098 Torulaspora d...
CDF87210     2034 YVEFLSPQIQLITNEEPDACIMVTSPGVKLEVVSFEGDTTNDEYRRDTIMKRYGVHVVNANVFYFRREDYM-D---YLDL 2109 Zygosaccharom...
XP_002496498 2048 FVEFLSPQIQMVSHEEPDSCVMLTSSGMKMEVVSFDGDLNGDEYRRNTMLKRYGIHVVNSNVFHFHRKDFM-D---HPAM 2123 Zygosaccharom...
ERT01229     2286 AYSGSSYGAPSGSSWPPWVPMEA 2308 Sporothrix schenckii ATCC 58251
CCH61833     2144 FFDPNPYGHHGVKNWPPWLGVEL 2166 Tetrapisispora blattae CBS 6284
Q6FSI2       2149 VFDASLYGQEKGSDWPPWLGAEV 2171 [Candida] glabrata
CCD24333     2140 YFDTNSYGQKKGSDWPPWLGLEL 2162 Naumovozyma dairenensis CBS 421
CCC71333     2145 FFDVSSYGQSKNSKWPPWLGLEL 2167 Naumovozyma castellii CBS 4309
CCK70267     2115 YFDMNSYGQKKGTEWPPWLGIEq 2137 Kazachstania naganishii CBS 8797
XP_003954883 2117 FFDMSSYGQVKGAEWPPWLGVEI 2139 Kazachstania africana CBS 2517
CCE93911     2099 FFSLSGYGQEDETQWPPWLSLDL 2121 Torulaspora delbrueckii
CDF87210     2110 YFNVAAYGHVEGTSWPPWVALEL 2132 Zygosaccharomyces bailii CLIB 213
XP_002496498 2124 YFDIAAYGHVEGTSWPPWVALEL 2146 Zygosaccharomyces rouxii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap