Conserved Protein Domain Family
Kin17_mid

?
pfam10357: Kin17_mid 
Domain of Kin17 curved DNA-binding protein
Kin17_mid is the conserved central 169 residue region of a family of Kin17 proteins. Towards the N-terminal end there is a zinc-finger domain, and in human and mouse members there is a RecA-like domain further downstream. The Kin17 protein in humans forms intra-nuclear foci during cell proliferation and is re-distributed in the nucleoplasm during the cell cycle.
Statistics
?
PSSM-Id: 402119
View PSSM: pfam10357
Aligned: 112 rows
Threshold Bit Score: 136.846
Threshold Setting Gi: 146452666
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAR25948          52 RKISQVSQTDIDEYTREFENDFLRLLKLAHGEKKIEANKFYNEYIQDKDHVHMNATRFTSLTKFIKYLGQTGKIRVHGVD 131 Zygosacchar...
A0E2M0            48 RLYNEDPDFYIEQFSQEFETAFMEILKEKYKDQKIGSNKVYEEMIRKVDHVHLNGTKWTKLTDFIQYLIANNKIGFDHSP 127 Paramecium ...
Q23U22            55 RQFAENPSEFLSTYSKEFENNFMDLLKKRFNQKRVLANTVYKEYIGDKTHVHMNSTKWTTLSGFVMYLHETGKVTADQTD 134 Tetrahymena...
XP_002974677      55 QIFGMSPGKFVGQFSHDFESAFMEHMKRNHRSSRVAANVVYNAYIQDRTHVHMNSSRWATLTDFVKYLGRTGKCKVEDTP 134 Selaginella...
XP_002966452      56 ELFAEKGDQLIEEYSQRFEDKFMEYMRRCYRSTSVPPNVVYNQITRERNHVRMNGTRWATLSEFVEHLGQTGKCKLEETE 135 Selaginella...
XP_006647303      55 QVFGQAPDRVVEGFSEEFLDAFLTLLRRAHRHSRIAATVVYNEFIADRHHVHMNSTRWATLTEFVKFLGREGHCKVEDTP 134 malo sina
EFH68092          16 QVFGQNPTRVVDGYSEEFEQTFLDLMRRSHRFSRIAATVVYNEYINDRHHVHMNSTEWATLTEFIKHLGKTGKCKVEETP 95  Arabidopsis...
XP_005848031      79 EIFGQNPHRIVEGYSEEFEKTFLDHLKQAHPFSRIAANVVYNEYINDRYHVHMNSTKWLTLTEFVKHLGRTGQCKVEETE 158 Chlorella v...
XP_002950705      48 ELFGMNPHRVVEGYSEEFEKAFMEHLRRAHPFSRVLAKNVYNEYITDRHHVHMNSTRWLTLTEFVKYLGKSGQCKVDETE 127 Volvox cart...
jgi:OSTLU_119540  49 AVFAQNQKKVVDGFSSRFKTAFISELSLNHRNSRVAANKVYNELIANKTHVHMNATRWTSLTEFVHHLVAEGVCEIDETD 128 Ostreococcu...
CAR25948         132 vskgnndksdedadddidmGQLMISYID--NSQGNLLRREKLQELAKDEKSDQEIKMMLLQRQM 193 Zygosaccharomyces rouxii
A0E2M0           128 -------------------GDIMIWNLN--LNPEKIKYDKVETKKVKLVEKQNALIDKSLEKQI 170 Paramecium tetraurelia
Q23U22           135 -------------------RGLFITYVD--KGLEAIKQQREEEKRARLEKKTEKMQQMELERQL 177 Tetrahymena thermophila SB210
XP_002974677     135 -------------------KGWFLTYID--REPETLLREGQKQKRIAAEAAGEDRHEREIVSMI 177 Selaginella moellendorffii
XP_002966452     136 -------------------KGLHLRFLEdpDHPETQFKEGLKRKRASGEAADIERHEREIQLQr 180 Selaginella moellendorffii
XP_006647303     135 -------------------KGWFITYID--RDSEQAVKARLKRKRIKSDLAEDERQERMIERQI 177 malo sina
EFH68092          96 -------------------KGWFITYID--RDSETLFKERLKNKRVKSDLAEEEKQEREIQKQI 138 Arabidopsis lyrata subsp. l...
XP_005848031     159 -------------------KGWFITLVH--RDEMEEIEGKKRAKRERAEQVEEERQRRMLQEQI 201 Chlorella variabilis
XP_002950705     128 -------------------KGWYITLIH--KDPKMQLEEERRNKRSEAEREEEERHMAALQEQI 170 Volvox carteri f. nagariensis
jgi:OSTLU_119540 129 -------------------KGIFITYLH--AES-KIFQGAVARKRTHEDDGSARKQEKLIERQV 170 Ostreococcus lucimarinus CC...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap