Conserved Protein Domain Family
Cohesin_load

?
pfam10345: Cohesin_load 
Cohesin loading factor
Cohesin_load is a common cohesin loading factor protein that is conserved in fungi. It is associated with the cohesin complex and is required in G1 for cohesin binding to chromosomes but dispensable in G2 when cohesion has been established. It is referred to as both Ssl3, in pombe, and Scc4, in S.cerevisiae. It complexes with Mis4.
Statistics
?
PSSM-Id: 402111
View PSSM: pfam10345
Aligned: 19 rows
Threshold Bit Score: 374.026
Threshold Setting Gi: 74605895
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDK42881      358 ELKVSYFLQESTKFIHAAHEHLAYYHEKINLENYWKLIKAAIRCLLLVLKkyNRSMTDFQKVSAIYSLAWIYSEETENFD 437  Lodderomyces ...
Q6CGW4          9 HEGRDLLIYTAHEILWTASSLASQVKTTEQLQQYRHLLTVGITSLETVIN--DRNCPQITRCYTMYILAQVLYCETACLD 86   Yarrowia lipo...
Q6CDL4         63 PECRDLIIYLAHEHLLQASIVAPLVKTREHLVQYRQMLATGIQMLETVIR--DANCPQSTQAYSAYILAQVLFSETECLD 140  Yarrowia lipo...
B4GF49         12 DACYISLLGLAEYFRTSQPPNVKKC----------------IQCLQALF---TFTPPSKVEARTHLQMGQILMAYTKNID 72   Drosophila pe...
Q16NZ8          6 DACYISLLGLAEYFRTSSPPNIKKC----------------IQCLQALF---TFKPPLKVEARTHLQLGQILMAYTKNTD 66   yellow fever ...
XP_007994083   23 DSWYLALLGFAEHFRTSSPPKIRLC----------------VHCLQAVF---PFKPPQRIEARTHLQLGSVLYHHTKNSE 83   green monkey
A7SUU7          8 DPCYAGLVGLAEGFRTSNPPRIREC----------------IQCLQAIL---QFNPPPATQAKTHLQIGRILQQYTKNDD 68   starlet sea a...
Q6CNT3         24 AQQLDLIYHLSKQYTLTAHDVVTEIETELELRQYYTLINQAIRCLRYLKDg-GFQLSLEQDFQITNDLVTLLIEETHRID 102  Kluyveromyces...
XP_001646299   12 KPRPELVYGLAHEYLEQAYKLSGKVSDEVQLQQYYTLISMGIKCLQRLKL--EYSLTVEQDAKITLELVHVLLNETNNLS 89   Vanderwaltozy...
Q6BID2        147 EMVVNNLVISSDYFLNRAHETVLDTNSMNGSKTYFKMIKISIKSLLLLIRkySKCLNPYLELIIYFKLARIYFIETENIN 226  Debaryomyces ...
EDK42881      438 KAQEYAN--KAIQICRSqgPSMIKYEFYCQLLL---ILIIVKTGGTAs-ALDYLAEITNLYET-----RGKQEFVDCLLL 506  Lodderomyces ...
Q6CGW4         87 RVESLLS--KGIGMASQ--SGLWDLVLQMECLN---VRVLSSTNRKA--ALYHCTKCLEKFSN-----MHENYSYYTLQM 152  Yarrowia lipo...
Q6CDL4        141 RVVSVLG--QGMILAQR--SGLSDLVLQMECLN---VRALCKTSRNA--ALLHCNKCLDKYQG-----MYDNYAYHTLQL 206  Yarrowia lipo...
B4GF49         73 MARQHLE--KAWNIAEPl-MNFDDVKFDTASVL---AQLHLQTDQSShtAKAMLRRAVELSQH---------NVYWHCKL 137  Drosophila pe...
Q16NZ8         67 LARNHLE--QAWMLSENi-NNFDDVKFDTASLL---AQLYQQQEQSSl-AKPVLRKAIELSQH---------NVYWHCKL 130  yellow fever ...
XP_007994083   84 QARSHLE--KAWLISQQi-PQFEDVKFEAASLL---SELYCQENSVDa-AKPLLRKAIQISQQ---------TPYWHCRL 147  green monkey
A7SUU7         69 LARRTLE--KA--VSAElgHGYEEISFEASSIL---SLVYKDQGQYPl-AKQVLRQALEITSG-------ENLYFWQFRL 133  starlet sea a...
Q6CNT3        103 LAEQYFSalRERLQS----TTWVNEKMYVDYVLlckIPLYKNDPSHNkiALRNLSKLISKLDT--------SLWKVLFQY 170  Kluyveromyces...
XP_001646299   90 LAEDYLSslRERLKNHK--LGVLNEKLHCEFIAlyeIPMKYSSEYYYkmSTRSCDSLLEYLKTlestqEVQEFWVPLFSF 167  Vanderwaltozy...
Q6BID2        227 RADDYVN--KAISIATR--NNLIKVKFICEFLA---AQILEKSNPKL--SLNYINERISNFKM-----IGLHSLGSLFAL 292  Debaryomyces ...
EDK42881      507 MRIHYLLAT----DYSIALVNLQRMLKRQNk-MHPILYTVASIYLAGLLTYRGDPKNAIMVLTNIkynfEPN-------- 573  Lodderomyces ...
Q6CGW4        153 YQFDLTLDT----SPQQAFEISQQWQNLPD--GPPKSFLVLYGFIKALDLNRHNTESNMAVLQQL----RQVeqqanlsf 222  Yarrowia lipo...
Q6CDL4        207 LRFDLTLDN----SLPQAFDIFKSWETLPD--SIPKSFLQLYGISKALDYNVGNYEETLLTLDHM----RAFeeasecte 276  Yarrowia lipo...
B4GF49        138 L-LQLSQIHasdrEYSLASELLAVGAESAEeaGATYLKVLFLLSRAMILMIERKTNDVLALLNTAg---QIIdnnipnph 213  Drosophila pe...
Q16NZ8        131 L-FQLAQTHatdkEYALASELLAVGVESTDetNATYLKTLFLLSRAMIMMIERKTGDVLTILNQAg---TMIdnavqnih 206  yellow fever ...
XP_007994083  148 L-FQLAQLHtlekDLVSACDLLGVGAEYARvvGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCg---QIVenwqgnpi 223  green monkey
A7SUU7        134 F-FQLAEVHacdnEFTASVEVLEMGERIAEqcGSQYMRYNIRHSHNCIIIVLLIMKDVNRVSNILmstgSFLerwqgqsy 212  starlet sea a...
Q6CNT3        171 FRLQLIp-----gNERKLADYRDILFVIKNh-EQFHFVVMCSFINYCLDEGISIPADMWVYFSEMdtahV---------- 234  Kluyveromyces...
XP_001646299  168 INIWLNIKIg--kKNLIRSKFNNLLEKSSKlnHEWEAFIILAYVSFLLDERYTVPPDVIEKLNEIntnrFSP-------- 237  Vanderwaltozy...
Q6BID2        293 LKIDNLLSQ----DPNTGLIVLQSLCQDPq--IDNTTRALCFIYQSNLHLYRGSPKHSLELLNHAeklmYGHeen----- 361  Debaryomyces ...
EDK42881      574 --SPLHALFLLNKLLAVMCTNDYYGATKVMSKLYDLKNRSDALK-------WRN-WHPDGDIELNITERdetnfnsnfns 643  Lodderomyces ...
Q6CGW4        223 yvPQVTMLRLMVTLMITLQRDHFQPVKEASNALEAFLGHLNQQAankpdksWDN-WYIDGSIKLTGGHG----------- 290  Yarrowia lipo...
Q6CDL4        277 tiPQVAMLRCMMTVLVALRRDCDIPVKEASKALETLLRSLNRKAskr-emvWKN-WNIDGTIKLAGARG----------- 343  Yarrowia lipo...
B4GF49        214 qkEYLKVFFLVLQVCYYLALGQVKTVKPSLKQLQMSIQTIMAPN-------WPT---DEAIFGANQ-------------- 269  Drosophila pe...
Q16NZ8        207 lkEYLKVFFYVLQVCHYLQLGQVKTVKTSLKQLQQSIQTIMAPNwpadeqiFGQs------------------------- 261  yellow fever ...
XP_007994083  224 qkESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHdd---eiLPSn------------------------- 275  green monkey
A7SUU7        213 qrESLVVFHLLLRVWQLLSVGQAKTVRPYLKQLQQSIQNLTTMTfegmqpgPNVy------------------------- 267  starlet sea a...
Q6CNT3        235 ---KLKIWKILLELLVLIFKDI--NITDKLTELKSFFDNNKDKIds---plESIhLFDTVSLKLDF-------------- 292  Kluyveromyces...
XP_001646299  238 ---TLVAWRMVLELMMQIYKEE--NITNKLNEFKEFFNQQKSNLenrdnycIKFdDSNRINITLPL-------------- 298  Vanderwaltozy...
Q6BID2        362 ypIQLQAILFLLKYSVYIHTDDSAGSKDVMQFISNFILTEQLKH-------WNS-WKEDGTFKIKIDIPssng-----ln 428  Debaryomyces ...
EDK42881      644 gF-KFIVPWLRVNDLLAVAYFINGLMFIGHKRD---YAEKNFHRATRQLERVKed--lKSNRNPSFTVQTLKEQYVKVRY 717  Lodderomyces ...
Q6CGW4        291 -S-TFNIQWLTQQQCVQLSYLLIALSRLRYYKTk-sAARELLKTCIRLTERDNd----TQAPLQASSFSHVSDALTQQLK 363  Yarrowia lipo...
Q6CDL4        344 -S-TFNIQWVTQSQCTQYCYYLLGLAALRHHTTl-kYGRELLKDCLKLLDRDQed--iPKEPLPRASISHISDNTAQKLA 418  Yarrowia lipo...
B4GF49        270 ---LEMFVWLPKEQLYVLVYLVTVSHSMMAGYMd--KAQKYTEKALTQIEKLK-----------------MQEDKPILSV 327  Drosophila pe...
Q16NZ8        262 --nTEMFMWLPKEQLYVLVYLVTVSHSMMAGYMd--KAQKYTEKALTQIEKLK-----------------SQENKPILAV 320  yellow fever ...
XP_007994083  276 --pADLFHWLPKEHMCVLVYLVTVMHSMQAGYLe--KAQKYTDKALMQLEKLK-----------------MLDCSPILSS 334  green monkey
A7SUU7        268 --eAEKFEWLPREHLCVLVYLVTVMHSMYAGYMd--KVLKYSAKALNQVERLK-----------------VTSPSALVSV 326  starlet sea a...
Q6CNT3        293 ----PVFGYKDVKNLLLFFQSVSYLPNCFDKRSn--FSVKFLPKTISTTGKLLss------lDEKCSLSKLNSLHKFYHT 360  Kluyveromyces...
XP_001646299  299 -----IFNYKDLKNILLLLQSISYLVNCYDKNAn--FSTKFLPKVQSTTKKLIds--lNDKSTSENSLSYWDAKINWYKS 369  Vanderwaltozy...
Q6BID2        429 sDlSYRVTWLNSDEFVIMFYFLTGVHFLPEIYNkkyKSKKVFQKCLQILDNQLhelrgMGNTERCFPLNQLTKKIIRLSF 508  Debaryomyces ...
EDK42881      718 FKFIIRYYLQYHAFVVDNW-DATCLNEFTTVARNALESKmehtCLKVQHPLVYYLQALWYLKKGDIQAAKYHFVkvrnlt 796  Lodderomyces ...
Q6CGW4        364 LQCTAYLYLSLIEFCSLAFkKGRRALDKFVSLSKKLPEK----EAEELQSLSWLVAGLGAHAGGRPENALGYYR------ 433  Yarrowia lipo...
Q6CDL4        419 LRCNVHLYIALVNFSGLAYkKGHRSFERFVTLSKGLPEE----ASDDLYSMSCLVAALSSQTSGKWKKALKYYK------ 488  Yarrowia lipo...
B4GF49        328 FKVILLEHIVMCRMVMGNReLAIREIAAARDVCLAVPHRs---LLKRHSAQLHCLIGLYSMSTSFFEHAERQFLvc---- 400  Drosophila pe...
Q16NZ8        321 FQIILLEHIIMCRLVMGNKsLAIKEIALAKDVCLSSSNKf---LLKKHSAQLHCLLGLYAMSASYFEHAERQFfa----- 392  yellow fever ...
XP_007994083  335 FQVILLEHIIMCRLVTGHKaTALQEISQVCQLCQQSPR-----LFSNHAAQLHTLLGLYCVSVNCMDNAEAQFtt----- 404  green monkey
A7SUU7        327 FQLMLLEHTIMCRVVQGQPaHAIKEISQVYQTLKHENC-----LVRAHKPILHTLLGLYAMSMNLMEQATTHFni----- 396  starlet sea a...
Q6CNT3        361 LLDLVKFYQTCESIILHGMvADDNTTS----------------------PYQDLLQAWNAQLRGQVKTASAIYYsi---- 414  Kluyveromyces...
XP_001646299  370 IISYCNFYQLWEQLILTPQkLINNDFSEISNTSQ-----------NSFDSYHTLMEGITSQIKGDGTLSLDQYStv---- 434  Vanderwaltozy...
Q6BID2        509 IRYYINYYQVWMNFLDKNFtNIDPLNEFLENYNNSKFSDeelcYYKLLIPNIFYLFGIFFQYKGDLKAAKYYYMrvrsft 588  Debaryomyces ...
EDK42881      797 rdvcledekq---alqqmrcgvgcesfmPQGKFNELYLYSSLHLVILLEyevadimrqgdkqlrtfcdkliglrnsiade 873  Lodderomyces ...
Q6CGW4        434 ----------------------------RISPQDGIYWAAIGNICSLDP------------------------------- 454  Yarrowia lipo...
Q6CDL4        489 ----------------------------RIESDDPLYPAALANICCINP------------------------------- 509  Yarrowia lipo...
B4GF49        401 ---------------------------vNETTERDLKLFANLNLAIIYLrtkr--------------------------d 427  Drosophila pe...
Q16NZ8        393 --------------------------ciNDTTERDLKLFANLNLAIVYLrmkr--------------------------e 420  yellow fever ...
XP_007994083  405 --------------------------alRLTNHQELWAFIVTNLASVYIregnr------------------------hq 434  green monkey
A7SUU7        397 --------------------------afKTADNPVLANFVGLNLSIIYIrages------------------------kq 426  starlet sea a...
Q6CNT3        415 --------------------------lhNDLGNRELKLLSLLHLYAITLaeisecdtgn--------------ddlhtlt 454  Kluyveromyces...
XP_001646299  435 --------------------------vrSKNATVEIRMISLLNSFIIKSsegikneq------------------shqsv 470  Vanderwaltozy...
Q6BID2        589 lyeqepsntieyssilqsslgvggetfqSKGQFSELYIYSTLHLVMLTEfevyqitksshtniin--drddtyrfrshly 666  Debaryomyces ...
EDK42881      874 ieLAKGGSKGKGKSSDMFQANFMMTNTLA--LMTTDLILCILQD------TSNIIPSNELRKMl---------------- 929  Lodderomyces ...
Q6CGW4        455 --SEENLNALRQTMGELPDEHHVVKNAMSeiIQLVQNSPDTTLL------QRQESMQKAWRAL----------------- 509  Yarrowia lipo...
Q6CDL4        510 --STANMDTLKQLINEMSPEHHGLKHAMFevIRLVHDTSNMSSL------DRQESMKKAQKAL----------------- 564  Yarrowia lipo...
B4GF49        428 adLKQILDAVSTENTHTYSSQALMGGFYY--VQGLHAFHKNSFH------EAKRFLRETLKMAn---------------- 483  Drosophila pe...
Q16NZ8        421 qeLRQILDQVQQENSQCSNSQALMGSFYY--VQGLNAFHKSSFH------EAKRFLRETLKMAn---------------- 476  yellow fever ...
XP_007994083  435 evLYSLLERINPDHSFPVSSHCLRAAAFY--VRGLFSFFQGRYN------EAKRFLRETLKMSn---------------- 490  green monkey
A7SUU7        427 ieLSSVMSSIHP-SNMATNSHSLQAGYYY--VCALRAFFQTRIQ------DAKKYLRESLKIAn---------------- 481  starlet sea a...
Q6CNT3        455 tkANQLVSQLDLLLNTSVFSASTVWRSTKllLVIMGRFEPFTKNpq--asNQNTLLLNELEQYfagnsllpad-----dl 527  Kluyveromyces...
XP_001646299  471 sdSHNIWQQVEKLLEESDLKENSIWECTLtiLWVTTHFKPFTDQplpctdEERSHYLEKLRVYynsnkiqglndveisvl 550  Vanderwaltozy...
Q6BID2        667 ldLTKIFDQKDKKTSNSFNMNLAGSSQTL--IITYNLLLSIYDNnysgsgKVNAESSEYPQILyda-------------- 730  Debaryomyces ...
EDK42881      930 ------tAISHKSAFYFIYFLITFALAtemvasvdQETIlhegmrvlppSQTKVIEEndeNLQQSESSpssvtttigtst 1003 Lodderomyces ...
Q6CGW4        510 -------NMGMTQQLSYVCSLVCVDRF--------DTIA----------EKTAAMES---SLQAAVAA------------ 549  Yarrowia lipo...
Q6CDL4        565 -------HLGMTQQLSYATTLACVDMF--------GSTA----------EKNLELGN---AFRTALSE------------ 604  Yarrowia lipo...
B4GF49        484 -------AEDLNRLTSCSLVLLSHVFLs------iGNSK----------ESMNMVTP---AMQLASKIpd---------- 527  Drosophila pe...
Q16NZ8        477 -------AEDLNRLTSCSLVLLSHVFLs------iGNSK----------ESMNMVTP---AMQLASKIpd---------- 520  yellow fever ...
XP_007994083  491 -------AEDLNRLTACSLVLLGHIFYv------lGNHR----------ESNNMVVP---AMQLASKIpd---------- 534  green monkey
A7SUU7        482 -------AEDLNRLTACSLVLLGHTFLa------sGNPQ----------EALNMVLP---ATQLSGKIpd---------- 525  starlet sea a...
Q6CNT3        528 ptskapvKIKKSLLLHIWLNYIAGSMSi-------NELD----------QRCVLSST---CFKLAKQQylpy-------- 579  Kluyveromyces...
XP_001646299  551 keegkylKLKKGLLLRILLNYLGCSLFe-------HDLE----------SICKISEV---CFNLSKLQdmpv-------- 602  Vanderwaltozy...
Q6BID2        731 -----mkGSNSMHSFPYLISLIHYVTYl------lSTSL----------ADKELALKmclSLVSMENCsd---------- 779  Debaryomyces ...
EDK42881     1004 stststknnvganetssisqsfsksetADSCRVFLLRSIHVI-MMQNGEHYKAETTQLLIDRLSK 1067 Lodderomyces elongisporus NR...
Q6CGW4        550 ---------------------------SDCVWAYVIGLKNEElLHQLGQQDKLDGLHRNMDKVKG 587  Yarrowia lipolytica
Q6CDL4        605 ---------------------------SDCVWAYVIGEKKKGyLHQLGQEEKLEQLNTSVANIGK 642  Yarrowia lipolytica
B4GF49        528 --------------------------iHVQLW---GSAILKDlHRMSKDAQHEKDAYANHVKYSE 563  Drosophila persimilis
Q16NZ8        521 --------------------------iHVQLW---GSAILKDlHRMLKEPALETEAYNNHCNFSQ 556  yellow fever mosquito
XP_007994083  535 --------------------------mSVQLW---SSALLRDlNKACGNAMDAHEAAQMHQNFSQ 570  green monkey
A7SUU7        526 --------------------------nYIQLW---AAGLLRDlYGMLGQPVQASESFHKHHSITK 561  starlet sea anemone
Q6CNT3        580 ------------------------lryLVGIWNLMNNTIAMNsKEVALTKARLDQIVKDLKANSD 620  Kluyveromyces lactis
XP_001646299  603 ------------------------iryIIGLWHLISCTSAMKsKEVTITRAKLEQTVQDIIALNQ 643  Vanderwaltozyma polyspora DS...
Q6BID2        780 --------------------------nERIVNLFILKDYSLQ-LHEEGDYDKGSLIETQLRYLHD 817  Debaryomyces hansenii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap