Conserved Protein Domain Family
ArAE_2_N

?
pfam10337: ArAE_2_N 
Putative ER transporter, 6TM, N-terminal
This is a family of proteins conserved in fungi. The function is not known. This family is the C-terminal half of some member proteins which contain the DUF2421 pfam10334 domain at their N-terminus. These proteins are putative endoplasmic reticulum tranpsorters, with a total of 12 TMs.
Statistics
?
PSSM-Id: 370988
View PSSM: pfam10337
Aligned: 15 rows
Threshold Bit Score: 358.221
Threshold Setting Gi: 119402492
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6CGZ8        117 FFRPAWLfDHMDIISFKTVIRSWIGVSLGFMLMMIPAFVRWCGSAPYLLPVVAVIVPAgSQPITVCFIINAIMCLFTCMG 196  Yarrowia lipo...
Q5B7J1         16 RRLPAFL-DHFSARELKIFFRCWVAVWVASLLIFIDPVATDFGQATFFACMVLFFLPP-AGVLFVYILGALSLFVGICLA 93   Aspergillus n...
Q0CRE9         21 HRLPAFL-DHFNARDLKVFFRCWVALWVASLLMFISPTLQNIGTATFFAALVLVMLPP-SGIVFIYVLGALSLFIGIFLA 98   Aspergillus t...
Q6BXJ5         82 IVRPAYFlDHLDYESFKVVSRTWVQLWVTVILMVIPKSGNWIGNAAYLMQIVGFIIAAgGTLIVLNVFLSILCFSYVMVS 161  Debaryomyces ...
EDK43048       93 IVYPNYIlNHLDYNSFKTIFRSWCYLWSAAILTIVPMTSHWLGSAAYLMLIVAMITISgGTSIIMNVLTALAWLIGMMIA 172  Lodderomyces ...
Q5AD04        121 VIWPNYIlNHLDYASFKIVCRSWCHVWSCAVLTIIPRTYYWLGNAAYLIVVLGFLSISgGSSIIMNVLASCAGLFGMMIA 200  Candida albicans
XP_001486677   80 RAKPEYItKHLDYALFKVVFRTWVQIWSSVIICVVPRSRTWVGPAAYLFQIIGFIAVSgGTSMVFNLAMSFMCMVYILIG 159  Meyerozyma gu...
Q6CGY7         52 YFRPSWVvDHLDFASFKVASRTWVGIWFGLMLMMIPGYVKWLGRAPYLTAIIGVIVPSgDMSVTVCFIVNAGMMLFTVFG 131  Yarrowia lipo...
Q6CBW6         26 FVHPDWFlNNLNLKSAKIILRNWAASFSMLFLLTVKPAWAWTGSSAHLALIMTVVQTSgQVSVIGAFIANCVLCAFIVWG 105  Yarrowia lipo...
Q6CDC6        139 FFHPWWFtDHLNLDGFIVILRDWIVSFTIIILMVVHKSARWLGPSCYLGLVMSIVMPSgQLSIISAFVINVLLMFFIMTG 218  Yarrowia lipo...
Q6CGZ8        197 YAVM-VIAMRINNTWFHNSINAEGMARQMIQEGLCAapd-sndPNSRATLTACVIDQVYAGKFMTARGSVVYCVLLGAFM 274  Yarrowia lipo...
Q5B7J1         94 WAWG-VIAMKAALAARPGAETQARVGALQQAAAAEA-------QETGASASSIAQRLVYNGWMLDARVTVIFYCMLCLFI 165  Aspergillus n...
Q0CRE9         99 WAWG-VIVMKAAQAARPAADTQARLASLQQTAAAQA-------NSTGVPVASIAQKMVYDGYMLDARVTSVTYCLLCLFI 170  Aspergillus t...
Q6BXJ5        162 WLFA-TIALLITNRLRGS-ITPEDLIKLLIQDGSC---------TAE-NILTCMTPQIFTGRFLTTRCTVIFVFCLMIGL 229  Debaryomyces ...
EDK43048      173 FVHH-VVRSKIINDMHGG-ITEQQLVQQLVEEGSC---------QLGDQLQDCVTEQIFSGRYITTKTVAITILSIITCT 241  Lodderomyces ...
Q5AD04        201 FVHH-VVRSKIINDLNHG-ITSQELAQQLIQEGSC---------QMNDQLQACVSEQIFTGRYITTKAAAISILSIISFT 269  Candida albicans
XP_001486677  160 WLHS-IIALAISVKLRGN-TSPQEYAESLIREGIC---------TME-NLEACTAADIYSGRHLQTRCTVIFIFAILSSM 227  Meyerozyma gu...
Q6CGY7        132 WIVM-IVAMYINNKYFHDSMTPKQMTQILIERGICKaptdptdPKAMAALQTCAQGAVFDAQFMTAKGSIVYAVLMGCFA 210  Yarrowia lipo...
Q6CBW6        106 WVCGyIIPGYIANRYFYDSVTQADILKDVISRGVCSa------SLPKKELIACMTDYCVHGHYMKAGPGVVYAIWVAVAC 179  Yarrowia lipo...
Q6CDC6        219 WVCAnIVPMRISNTYFYDRWTVTDFMQDVVNRGLCSa------DLSKTELMTCLNEHASRGIYMKGSTSAIYAFWLGVTG 292  Yarrowia lipo...
Q6CGZ8        275 FFMLWMKNKSRI-LIPGYLCGVIAVGALMPLAHMFPYfSPNTIGLTLVKPMGLQFAINVALSILVFPFSSGFQFTQTALS 353  Yarrowia lipo...
Q5B7J1        166 YFMARLRAANPK-ATLTSIFGIIIIDMFLCYGPILTS-FNGTLPLPLVKPSATAVGLGAVCSIIFFPRSTSDIILEDMQG 243  Aspergillus n...
Q0CRE9        171 YLMARLRANNPK-LAFTSIYGIIITDLFLNFTPLLPS-FKGMLPLSLVKPAAIGVGLGVACSILFFPRSTSHVVLDSLED 248  Aspergillus t...
Q6BXJ5        230 TMYG-MTLRLHPlIRPGFVAGIISLIVLTNYYVYFPVfMPKVIGYTIIKPMGIAFLTKIVTSILIFPTTSSFLYFNGSSK 308  Debaryomyces ...
EDK43048      242 MIVGNMRQRLHPlWSLVYIGGQIANVIFSCYGHFSPLyQPLSVGFQVMRPTGISLVLKVLSAFVVFPTTSNRNYLQGSLG 321  Lodderomyces ...
Q5AD04        270 FIVGNIRQHAHPlWTLAYIGGQFGSCIFTCYGHFSPLyQPLEIGLIVLKPFGLSLSVKVLTSLIVYPTTSNWLFFQGSIK 349  Candida albicans
XP_001486677  228 IIFG-LSLRIHPtFRQGMICGIIAMLINVCYDVFYPVfLPLQVGLAVLKPMGLALALKVVCLMVVFPTTSNFRYVDGVLK 306  Meyerozyma gu...
Q6CGY7        211 FFLLWVKNKSRI-IIPGYVCGIIAMSVLLTVGPMVPYyQPITLGVVLLKPVGLQCAINFSLSVLIFPFTTGFQFTKTVIG 289  Yarrowia lipo...
Q6CBW6        180 TVCFWCKFHDPMtFAAGASTSFIAAAVAADSAMHFPWyAPKTIGAGMLKPMGIGLAANVVVAIIFFPFTSGYQFTTKLLR 259  Yarrowia lipo...
Q6CDC6        293 CIHFYFKFKHPV-YIPGAITGMIAACVSLVSSVHTPWfDAKEVGTGMMKPMGLALALNMFVAIVICPVTSSHQYMDMIKK 371  Yarrowia lipo...
Q6CGZ8        354 ELKILEGLVKFHENFMTSTLPSNeadwlnfSQTEADVQKARQLYPKLEAEAALLPIELTYSRFAFPDYTALKTSVGRVIS 433  Yarrowia lipo...
Q5B7J1        244 LLELLKSSLQLSYSALGRSSDQLg-----pQQLQKWRMKIIAHYRTLEPSFGFLPLDFHIGSWGAEVVTTFREPVRHLVA 318  Aspergillus n...
Q0CRE9        249 IVAQLKAPLTFTATTLGQKAQQPd-----mHRLQKIRIQIFGEYKKMEPALAFLPLDFSVGCWGAEEVMQLKEPMRKTVM 323  Aspergillus t...
Q6BXJ5        309 ILSGLNKATKNNINFMKTLRPSGpdf-snfEKYSKEITNFRNNISQLEVLASTIKYEISFGRLDAGDAGEFRYLLKNLIN 387  Debaryomyces ...
EDK43048      322 ILSAVKEINVKNTRLFNTMRPSApnf-anyKQIKKDITGVRSKMAPLEIVASTIWLEYSYGRFDVGDIGQFRSTCKNLIT 400  Lodderomyces ...
Q5AD04        350 FMTQLQKAMDGNTKMFKTLKPSApnf-snyKAYKKDITKLRSSMAPSENVASTIWLEYSYGRFDVGDVGEFRSLLKNLIS 428  Candida albicans
XP_001486677  307 HLKALEKACKGNSRFLSSCKPSEpnf-gnyKKFARDIVGIRLKLPLLDLDALLSKYEITFGRFDAGSIGEMRSSLRNVIS 385  Meyerozyma gu...
Q6CGY7        290 EISVLSGLVDFHQQFLGSSLPSNesewlkfSEIEADVTKARQLYPKMQSESAMLHLELSFARFCHHHYEGLKVAVGRLTS 369  Yarrowia lipo...
Q6CBW6        260 FQGAVVQTLEWQVGFLAQAKPSVpdtwlgyWKLEQCVSGLRSLGPVLRMSSGPIPLEFSFTRFTIAGYQSARITARRLTS 339  Yarrowia lipo...
Q6CDC6        372 EYMLLSSLIKFQRKFVAETRPSNetewlkfNTIEGLILKIRGLFPVLSAMESSMPMEVTITRYSLAHYPSAKITVSRLAS 451  Yarrowia lipo...
Q6CGZ8        434 GMSGLVYFYDNVENIrrsillve---tagrpidmSRKLADstgNDSRKVDSmlkrrkkdtgrfDIDEKKkpAPVGVYEIK 510  Yarrowia lipo...
Q5B7J1        319 AILTLSEFHKETVEKri----------------qTQELELkdpSIHQHEDG------------TDEKKD--RKVGAHHRS 368  Aspergillus n...
Q0CRE9        324 AIATLLGls------------------------hQSHIRRgqrGQSALENL------------RKTRVSfvRDMTNTLVD 367  Aspergillus t...
Q6BXJ5        388 LSAGYEYFYQLLYERldvvsdnir-glgrsrassTSSYNRkkiTGHSKLFT------------ALQQSY--RSVGEYENS 452  Debaryomyces ...
EDK43048      401 ATASYAHFYQLLQERtyfakddfg--itrrksnaSS-LAH----GHAKLFS------------AIQDSY--RKVGEYETR 459  Lodderomyces ...
Q5AD04        429 SSASYAYFYQLLQERtfyakddfa--ivrkksnaSSHLAH----GHAKLFS------------AIQDSY--KKVGKYESE 488  Candida albicans
XP_001486677  386 FSSSFEQYYQMFEERvdlannnirglsrrrssvgSSKFED---DGHSKLFA------------TVHEHY--RVVGEYEDK 448  Meyerozyma gu...
Q6CGY7        370 SMAGLVYFYDNIENIrraii----------isaeA--------DEAIRAVP------------SQEESEtvPPVGVYEMK 419  Yarrowia lipo...
Q6CBW6        340 QLTGLIMIFDSIEHLrrvii----------edkeA---------SIEPVIS------------EIHKKY--APVGVYETQ 386  Yarrowia lipo...
Q6CDC6        452 MMSGFSMFYDSMENLrhavleyhk--gdtqtlerQLSFAIgtdNTKPDKKS------------KKPKDY--APVGAFETQ 515  Yarrowia lipo...
Q6CGZ8        511 TGIKGAKaqy------------------pdSLTMEELDALM--IQLREMSLPFVEQVRLALETMIKWLAAANVYR-VNSL 569  Yarrowia lipo...
Q5B7J1        369 QLAELIQgl-------------------qyTQHHSIPEDVA--SEFISLSSNAMEACLDGLSVIGECLQFVDRQR-WYHK 426  Aspergillus n...
Q0CRE9        368 EYIRLEEgq-------------------tdSTKVDRLRGLVvgMVFEEHMANTVDQIETLLDRILTMYTTSTRVRlWWPT 428  Aspergillus t...
Q6BXJ5        453 RRIKLLRnriys-------------sdaedDLTLKDLDIVA--RFITAHFISVLEAVDIGLESVATWLTEANKFR-TYTI 516  Debaryomyces ...
EDK43048      460 KRVRVLRnrimy-------------hgrghRISVLDIDLIA--KFLNQHFGVLLDVANTGIQDIIEWLRAANEFR-IYS- 522  Lodderomyces ...
Q5AD04        489 KRMKVLRnriai-------------hgagnRMTLGGIDEVA--KFMSKHFTPLLEDANLGIQTIIEWLEAANEFR-IYA- 551  Candida albicans
XP_001486677  449 KRINLLRkricn-------------vdpqdRVTLLDIVHIS--ELSSTLFTRFLETNTKSIADIIKWIEAANQFR-IYS- 511  Meyerozyma gu...
Q6CGY7        420 SGLRNRTalqqk--------------atlrELTMQDLDLLI--LQLRQMSTPFIQEVCKSLDVIKRWLEAANVYR-GNSL 482  Yarrowia lipo...
Q6CBW6        387 HSVASVLrqs------------------ekPVTLSDLDETI--QTLSDICGPMVLEQAGMMKVAIKWITVANDFR-GWS- 444  Yarrowia lipo...
Q6CDC6        516 HSMAGILrdewkrasvqeqdggskavssdpPFSMADLDHVM--ETLDRISGPVLDSVAELLDTMVSWTNACNHFR-TYAY 592  Yarrowia lipo...
Q6CGZ8        570 FFFWQKKGHRQRQTelaaelAERRQAFKEAAHDFLNSKRFELFQSLE 616  Yarrowia lipolytica
Q5B7J1        427 APSAAHEELQERT-------KTVLERLLQTRAAFLADMTESLVRAYG 466  Aspergillus nidulans
Q0CRE9        429 SLKYAAQWFSKKKTpapdtaPATDSDPDDQVDDLTKAAQEKLRMRRA 475  Aspergillus terreus NIH2624
Q6BXJ5        517 IIPGSHEKHKQRQQerkeslLDAKRRLKNELEKWSDHKRIEKLMQGT 563  Debaryomyces hansenii
EDK43048      523 WIPGRWQKHCEKQKemaarvKNSKKEIEQALLKFDDPEVLKNMMFDN 569  Lodderomyces elongisporus NRRL YB-4239
Q5AD04        552 WLPGKWNMHVSKQKeingkvFKARTTLKDSLCKFEDVETMKKMMVDS 598  Candida albicans
XP_001486677  512 LLPKKWELHKEKQKemnevlVETRQTLLVAIKELGSTDKLIAAVKEF 558  Meyerozyma guilliermondii ATCC 6260
Q6CGY7        483 FFFWMSKSFKQQQKqlseelRERYADFQRESKDLLESKRFALFGEHE 529  Yarrowia lipolytica
Q6CBW6        445 WLPWLHKKHVLDQQtmaleiSSAYEHFSKATESF-REKRFAVTENTM 490  Yarrowia lipolytica
Q6CDC6        593 FLPWMRKKRVALQKeqaaqlVEVYERYKVVRDQF-IADRYTIFTGAE 638  Yarrowia lipolytica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap