Conserved Protein Domain Family
DUF2420

?
pfam10336: DUF2420 
Protein of unknown function (DUF2420)
This is a family of proteins conserved in fungi. The function is not known.
Statistics
?
PSSM-Id: 402105
View PSSM: pfam10336
Aligned: 35 rows
Threshold Bit Score: 94.5502
Threshold Setting Gi: 238849018
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004197793 248 LYDDQNVLNSSLESFFVSMRNHEDLNEICS--FDASRELVLTVPELgNITITEDNIYSREVSVNDFVDRFHDFKLNSklH 325  Pichia farinos...
XP_016763753 361 LLKDDNLLNVSLTDLLNNIRMRLASKVDEAdmITKARELVLNFDLF-GSMVAESSLHASATSLNDVLGVYLALHENDg-V 438  Sphaerulina mu...
EGP89887     304 LLKDDNLASLSLSNLMANCRQRLEYKIGES--ISADQDLVLSVQNM-GLIVGENSPYAFQTSLSEILEVYIQLHQND--- 377  Zymoseptoria t...
EME86725     298 LLKDDNLVNVSLAELLSSCKQRLNQRLGDA--VSEDQDLVLGFDRI-GLMLMECSTHASAISLNDVLEVYMNLYQND--- 371  Pseudocercospo...
EME47396     324 lLKNDNLANVSLSDLITSCRERLSVKTGQA--VADTQNLVIGFDSM-GLVLVEGSPSASETSLGDVLDVYLLLHRND--- 397  Dothistroma se...
EFW18763     352 LLEDEELAHAPLYQLFQAFRKVLGNN------MSDEDELVASIDCL-YIQLSEVATQSSEINLSQIVQLYLDLSRND--- 421  Coccidioides p...
Q0V231       286 LTEDTSIIHSSLSEMFQACRASLGEN------ISNETELGLRFDHFhNMEIFEDSTACVAVSLGRMIDLYYTLHAQD--- 356  Parastagonospo...
XP_003837658 342 LLDDISLTRSRISDVFQACRASLGDD------VSTEHEIGFRFDHLhNLELYEDNTACVAVSLDKLVDLYHTLQAQD--- 412  Leptosphaeria ...
EFQ87382     456 LIEDASLAKASMSDLMRACRYSLGDD------VSNEMEIGFRFDHFlNMELFEDNTACVAVSLERLVNYYHMLYAND--- 526  Pyrenophora te...
EOA85308     329 LLEDISVVKASLSTLFQACRSAVGEE------ALQGMEIGFRFEHFeNMELFEENTACVAVSLERLLSYYHSLHAQD--- 399  Exserohilum tu...
XP_004197793 326 DSELLFQTLSFKLSFQTRFISEFNNLSKLLRE 357  Pichia farinosa CBS 7064
XP_016763753 439 SEHDTP-PLSMTLTSQPNFSHNLASLKQMAAt 469  Sphaerulina musiva SO2202
EGP89887     378 GTSTIP-PLALSLSLQLKFSSSFNLFKVAAQQ 408  Zymoseptoria tritici IPO323
EME86725     372 GVEDIP-RLSMTLTTQLKFTSHLKLLKEAAVs 402  Pseudocercospora fijiensis CIRAD86
EME47396     398 GHDDVP-PLSMTLTVQFKFTSHLQMIKQAAFQ 428  Dothistroma septosporum NZE10
EFW18763     422 -GVDNPEPLYICLSSRPILDAELAALQAAVDQ 452  Coccidioides posadasii str. Silveira
Q0V231       357 -GESEPESFYMCLLSRPRFATLLSDIAKHADQ 387  Parastagonospora nodorum SN15
XP_003837658 413 -GNNAPESFYISLLFRPRFATLLSDIAKFADQ 443  Leptosphaeria maculans JN3
EFQ87382     527 -GNNEPESFYITLLFRPRFATLLSDIAKFADQ 557  Pyrenophora teres f. teres 0-1
EOA85308     400 -GNNTPDSFYITLMYRPRFATLLADIARCADQ 430  Exserohilum turcica Et28A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap